Crystal structure of ricin A chain in complex with 5-(o-tolyl)thiophene-2-carboxylic acid. Determined by X-ray diffraction at 1.52 Å resolution. Released 9 Feb 2022.
Explore 7MLN in 3D Show helices and sheets RCSB PDB PDBe
7MLN contains 15 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-12 | 5 | 1 |
| α-helix | 18-32 | 15 | |
| β-strand | 38-39 | 2 | 2 |
| β-strand | 42-43 | 2 | 2 |
| β-strand | 44 | 1 | 3 |
| α-helix | 45-47 | 3 | |
| α-helix | 53-55 | 3 | |
| β-strand | 57-63 | 7 | 1 |
| β-strand | 69-75 | 7 | 1 |
| β-strand | 81-86 | 6 | 1 |
| β-strand | 89-92 | 4 | 1 |
| α-helix | 93-95 | 3 | |
| α-helix | 98-104 | 7 | |
| β-strand | 113-116 | 4 | 1 |
| α-helix | 123-130 | 8 | |
| α-helix | 134-136 | 3 | |
| β-strand | 139 | 1 | 4 |
| α-helix | 141-154 | 14 | |
| α-helix | 161-172 | 12 | |
| α-helix | 173-177 | 5 | |
| α-helix | 178-180 | 3 | |
| α-helix | 182-193 | 12 | |
| β-strand | 198 | 1 | 4 |
| α-helix | 199-201 | 3 | |
| α-helix | 202-219 | 18 | |
| β-strand | 222 | 1 | 5 |
| β-strand | 225-233 | 9 | 5 |
| β-strand | 239-244 | 6 | 5 |
| α-helix | 246-248 | 3 | |
| β-strand | 255 | 1 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ricin | A | protein | 268 | Ricinus communis | P02879 (AlphaFold model) |
>7MLN_1 Ricin (chains A) MIFPKQYPIINFTTAGATVQSYTNFIRAVRGRLTTGADVRHEIPVLPNRVGLPINQRFIL VELSNHAELSVTLALDVTNAYVVGYRAGNSAYFFHPDNQEDAEAITHLFTDVQNRYTFAF GGNYDRLEQLAGNLRENIELGNGPLEEAISALYYYSTGGTQLPTLARSFIICIQMISEAA RFQYIEGEMRTRIRYNRRSAPDPSVITLENSWGRLSTAIQESNQGAFASPIQLQRRNGSK FSVYDVSILIPIIALMVYRCAPPPSSQF
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZJA | 5-(2-methylphenyl)thiophene-2-carboxylic acid | C12 H10 O2 S | 1 |
Water and common crystallization additives (GOL) are not listed.
Synthesis and Structural Characterization of Ricin Inhibitors Targeting Ribosome Binding Using Fragment-Based Methods and Structure-Based Design. Li, X.P., Harijan, R.K., Cao, B. et al. J Med Chem (2021) 64:15334-15348. DOI 10.1021/acs.jmedchem.1c01370 · PubMed
Other PDB entries of the same protein (UniProt P02879 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7MLN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.