Crystal structure of HCV NS3/4A protease in complex with NR01-115. Determined by X-ray diffraction at 1.89 Å resolution. Released 16 Mar 2022.
Explore 7MM4 in 3D Show helices and sheets RCSB PDB PDBe
7MM4 contains 10 α-helices and 22 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 992 | 1 | 1 |
| β-strand | 993-999 | 7 | 2 |
| β-strand | 1006-1009 | 4 | 2 |
| α-helix | 1013-1022 | 10 | |
| β-strand | 1024 | 1 | 3 |
| β-strand | 1031 | 1 | 4 |
| β-strand | 1033-1037 | 5 | 2 |
| β-strand | 1042-1048 | 7 | 2 |
| β-strand | 1051-1055 | 5 | 2 |
| α-helix | 1056-1059 | 4 | |
| β-strand | 1064 | 1 | 1 |
| β-strand | 1066 | 1 | 3 |
| β-strand | 1071 | 1 | 1 |
| β-strand | 1075-1077 | 3 | 2 |
| α-helix | 1078-1080 | 3 | |
| β-strand | 1082-1086 | 5 | 2 |
| α-helix | 1087-1088 | 2 | |
| β-strand | 1091 | 1 | 4 |
| α-helix | 1093 | 1 | |
| β-strand | 1094 | 1 | 2 |
| α-helix | 1095 | 1 | |
| β-strand | 1096 | 1 | 5 |
| α-helix | 1097 | 1 | |
| β-strand | 1103-1107 | 5 | 5 |
| β-strand | 1113-1118 | 6 | 5 |
| β-strand | 1123-1131 | 9 | 5 |
| α-helix | 1132-1134 | 3 | |
| α-helix | 1141 | 1 | |
| β-strand | 1142-1144 | 3 | 5 |
| β-strand | 1150-1160 | 11 | 5 |
| β-strand | 1163-1171 | 9 | 5 |
| α-helix | 1172-1178 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| NS3 protease | A | protein | 200 | Hepacivirus C | P26664 (AlphaFold model) |
>7MM4_1 NS3 protease (chains A) HMASMKKKGSVVIVGRINLSGDTAYAQQTRGEEGCQETSQTGRDKNQVEGEVQIVSTATQ TFLATSINGVLWTVYHGAGTRTIASPKGPVTQMYTNVDKDLVGWQAPQGSRSLTPCTCGS SDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGIFRAAVSTR GVAKAVDFIPVESLETTMRS
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZKA | (1-methylcyclopropyl)methyl {(2R,4S,6S,12Z,13aS,14aR,16aS)-2-[(7-methoxy-3-meth… | C38 H50 N6 O9 S | 1 |
| ZN | Zinc ion | Zn | 1 |
Water and common crystallization additives (SO4, EDO) are not listed.
Deciphering the Molecular Mechanism of HCV Protease Inhibitor Fluorination as a General Approach to Avoid Drug Resistance. Zephyr, J., Nageswara Rao, D., Vo, S.V. et al. J Mol Biol (2022) 434:167503-167503. DOI 10.1016/j.jmb.2022.167503 · PubMed
Other PDB entries of the same protein (UniProt P26664 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7MM4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.