7MNZ: Nup358/RanBP2 Ran-binding domain 4
Crystal Structure of Nup358/RanBP2 Ran-binding domain 4 in complex with Ran-GPPNHP. Determined by X-ray diffraction at 2.35 Å resolution. Released 15 Jun 2022.
- Method
- X-ray diffraction
- Resolution
- 2.35 Å
- Organism
- Homo sapiens
- Chains
- 12
- Atoms
- 17,360
- Mol. weight
- 246.99 kDa
- Ligands
- MG, GNP
- Released
- 15 Jun 2022
Explore 7MNZ in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
7MNZ contains 73 α-helices and 96 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 11 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 9-17 | 9 | 1 |
| α-helix | 23-32 | 10 | |
| β-strand | 40 | 1 | 2 |
| β-strand | 45-54 | 10 | 1 |
| β-strand | 57-66 | 10 | 1 |
| α-helix | 70-72 | 3 | |
| α-helix | 76-80 | 5 | |
| β-strand | 85-91 | 7 | 1 |
| α-helix | 95-99 | 5 | |
| α-helix | 101-112 | 12 | |
| β-strand | 117-122 | 6 | 1 |
| α-helix | 138-142 | 5 | |
| β-strand | 145-148 | 4 | 1 |
| α-helix | 159-169 | 11 | |
| β-strand | 176 | 1 | 1 |
| α-helix | 178-180 | 3 | |
| α-helix | 182-185 | 4 | |
| α-helix | 187-189 | 3 | |
| α-helix | 194-204 | 11 | |
| β-strand | 207 | 1 | 3 |
Chain B: 1 helix, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2930-2944 | 15 | 4 |
| β-strand | 2949-2963 | 15 | 4 |
| β-strand | 2969-2975 | 7 | 4 |
| β-strand | 2981-2986 | 6 | 4 |
| β-strand | 2994-2995 | 2 | 4 |
| β-strand | 3002-3009 | 8 | 4 |
| β-strand | 3016-3024 | 9 | 4 |
| α-helix | 3027-3042 | 16 | |
Chain C: 12 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 10-17 | 8 | 5 |
| α-helix | 23-32 | 10 | |
| β-strand | 45-54 | 10 | 5 |
| β-strand | 57-66 | 10 | 5 |
| α-helix | 70-72 | 3 | |
| α-helix | 77-80 | 4 | |
| β-strand | 85-91 | 7 | 5 |
| α-helix | 95-99 | 5 | |
| α-helix | 101-112 | 12 | |
| β-strand | 117-122 | 6 | 5 |
| α-helix | 133-135 | 3 | |
| α-helix | 138-141 | 4 | |
| β-strand | 145-148 | 4 | 5 |
| α-helix | 159-169 | 11 | |
| β-strand | 176 | 1 | 5 |
| α-helix | 178-180 | 3 | |
| α-helix | 182-185 | 4 | |
| α-helix | 194-204 | 11 | |
| α-helix | 208-210 | 3 | |
Chain D: 1 helix, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2909-2917 | 9 | 6 |
| β-strand | 2930-2944 | 15 | 7 |
| β-strand | 2949-2963 | 15 | 7 |
| β-strand | 2969-2974 | 6 | 7 |
| β-strand | 2981-2986 | 6 | 7 |
| β-strand | 2994-2995 | 2 | 7 |
| β-strand | 3002-3009 | 8 | 7 |
| β-strand | 3016-3024 | 9 | 7 |
| α-helix | 3027-3042 | 16 | |
Chain E: 10 helices, 11 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 9-17 | 9 | 8 |
| α-helix | 23-32 | 10 | |
| β-strand | 40 | 1 | 3 |
| β-strand | 45-54 | 10 | 8 |
| β-strand | 57-66 | 10 | 8 |
| α-helix | 70-72 | 3 | |
| α-helix | 76-80 | 5 | |
| β-strand | 85-91 | 7 | 8 |
| α-helix | 95-99 | 5 | |
| α-helix | 101-112 | 12 | |
| β-strand | 117-122 | 6 | 8 |
| α-helix | 138-142 | 5 | |
| β-strand | 145-148 | 4 | 8 |
| β-strand | 150 | 1 | 9 |
| β-strand | 155 | 1 | 9 |
| α-helix | 159-169 | 11 | |
| β-strand | 176 | 1 | 8 |
| α-helix | 178-180 | 3 | |
| α-helix | 182-185 | 4 | |
| α-helix | 191-205 | 15 | |
| β-strand | 207 | 1 | 2 |
Chain F: 1 helix, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2930-2944 | 15 | 10 |
| β-strand | 2949-2963 | 15 | 10 |
| β-strand | 2969-2975 | 7 | 10 |
| β-strand | 2981-2986 | 6 | 10 |
| β-strand | 2994-2995 | 2 | 10 |
| β-strand | 3002-3009 | 8 | 10 |
| β-strand | 3016-3023 | 8 | 10 |
| α-helix | 3027-3042 | 16 | |
Chain G: 12 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 10-17 | 8 | 11 |
| α-helix | 23-32 | 10 | |
| β-strand | 45-54 | 10 | 11 |
| β-strand | 57-66 | 10 | 11 |
| α-helix | 70-72 | 3 | |
| α-helix | 76-80 | 5 | |
| β-strand | 85-91 | 7 | 11 |
| α-helix | 95-99 | 5 | |
| α-helix | 101-112 | 12 | |
| β-strand | 117-122 | 6 | 11 |
| α-helix | 138-142 | 5 | |
| β-strand | 145-148 | 4 | 11 |
| α-helix | 159-169 | 11 | |
| β-strand | 176 | 1 | 11 |
| α-helix | 178-180 | 3 | |
| α-helix | 182-185 | 4 | |
| α-helix | 187-189 | 3 | |
| α-helix | 191-193 | 3 | |
| α-helix | 194-206 | 13 | |
Chain H: 1 helix, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2909-2917 | 9 | 6 |
| β-strand | 2930-2944 | 15 | 12 |
| β-strand | 2949-2963 | 15 | 12 |
| β-strand | 2969-2974 | 6 | 12 |
| β-strand | 2981-2986 | 6 | 12 |
| β-strand | 2994-2995 | 2 | 12 |
| β-strand | 3002-3009 | 8 | 12 |
| β-strand | 3016-3023 | 8 | 12 |
| α-helix | 3027-3042 | 16 | |
3 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| GTP-binding nuclear protein Ran | A, C, E, G, I, K | protein | 216 | Homo sapiens | P62826 (AlphaFold model) |
| E3 SUMO-protein ligase RanBP2 | B, D, F, H, J, L | protein | 139 | Homo sapiens | P49792 |
Sequence of entity 1 (A, C, E, G, I, K), FASTA
>7MNZ_1 GTP-binding nuclear protein Ran (chains A, C, E, G, I, K)
SMAAQGEPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPI
KFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVL
CGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAM
PALAPPEVVMDPALAAQYEHDLEVAQTTALPDEDDD
Sequence of entity 2 (B, D, F, H, J, L), FASTA
>7MNZ_2 E3 SUMO-protein ligase RanBP2 (chains B, D, F, H, J, L)
GPGSHFEPIVSLPEVEVKSGEEDEEILFKERAKLYRWDRDVSQWKERGVGDIKILQNYDN
KQVRILMRRDQVFKVCANHVITKTMELKPLNVSNNALVWTASDYADGEAKVEQLAVRFKT
KEVADCFKKTFEECQQNLM
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| MG | Magnesium ion | Mg | 6 |
| GNP | Phosphoaminophosphonic acid-guanylate ester | C10 H17 N6 O13 P3 | 6 |
Primary citation
Architecture of the cytoplasmic face of the nuclear pore. Bley, C.J., Nie, S., Mobbs, G.W. et al. Science (2022) 376:eabm9129-eabm9129. DOI 10.1126/science.abm9129 · PubMed
Other PDB entries of the same protein (UniProt P62826 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 3GJ0 1.48 Å, Crystal structure of human RanGDP
- 7MO5 1.55 Å, Crystal Structure of the ZnF4 of Nucleoporin NUP153 in complex with Ran-GDP
- 7MO1 1.6 Å, Crystal Structure of the ZnF1 of Nucleoporin NUP153 in complex with Ran-GDP
- 5CIQ 1.65 Å, Ran GDP wild type tetragonal crystal form
- 7MO2 1.65 Å, Crystal Structure of the ZnF2 of Nucleoporin NUP153 in complex with Ran-GDP
- 5CIT 1.75 Å, Ran GDP wild type monoclinic crystal form
- 5CIW 1.75 Å, Ran GDP Y39A mutant monoclinic crystal form
- 5CJ2 1.75 Å, Ran GDP Y39A mutant triclinic crystal form
- 1I2M 1.76 Å, Ran-RCC1-SO4 complex
- 4HAT 1.78 Å, Crystal structure of CRM1 inhibitor Leptomycin B in complex with CRM1-Ran-RanBP1
- 3GJ3 1.79 Å, Crystal structure of human RanGDP-Nup153ZnF2 complex
- 3GJ5 1.79 Å, Crystal structure of human RanGDP-Nup153ZnF4 complex
Browse structure collections
About this viewer
MolViewer shows 7MNZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.