Crystal Structure of Nucleoporin NUP50 Ran-Binding Domain in Complex with Ran-GPPNHP. Determined by X-ray diffraction at 2.45 Å resolution. Released 15 Jun 2022.
Explore 7MO0 in 3D Show helices and sheets RCSB PDB PDBe
7MO0 contains 24 α-helices and 33 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 10-17 | 8 | 1 |
| α-helix | 23-31 | 9 | |
| β-strand | 45-54 | 10 | 1 |
| β-strand | 57-66 | 10 | 1 |
| α-helix | 70-73 | 4 | |
| α-helix | 77-80 | 4 | |
| β-strand | 85-91 | 7 | 1 |
| α-helix | 95-99 | 5 | |
| α-helix | 101-112 | 12 | |
| β-strand | 117-122 | 6 | 1 |
| β-strand | 144-148 | 5 | 1 |
| β-strand | 150 | 1 | 2 |
| β-strand | 155 | 1 | 2 |
| α-helix | 159-169 | 11 | |
| β-strand | 176-177 | 2 | 1 |
| α-helix | 178-180 | 3 | |
| α-helix | 191-203 | 13 | |
| α-helix | 208-211 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 344-346 | 3 | |
| α-helix | 351-353 | 3 | |
| β-strand | 359-369 | 11 | 3 |
| β-strand | 372-385 | 14 | 3 |
| β-strand | 391-397 | 7 | 3 |
| β-strand | 404-409 | 6 | 3 |
| β-strand | 416-419 | 4 | 3 |
| β-strand | 423-428 | 6 | 3 |
| β-strand | 443-448 | 6 | 3 |
| α-helix | 452-467 | 16 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9-17 | 9 | 4 |
| α-helix | 23-31 | 9 | |
| β-strand | 45-52 | 8 | 4 |
| β-strand | 53-54 | 2 | 5 |
| β-strand | 59-66 | 8 | 4 |
| α-helix | 77-80 | 4 | |
| β-strand | 85-91 | 7 | 4 |
| α-helix | 95-99 | 5 | |
| α-helix | 101-112 | 12 | |
| β-strand | 117-122 | 6 | 4 |
| α-helix | 138-140 | 3 | |
| β-strand | 144-148 | 5 | 4 |
| β-strand | 150 | 1 | 6 |
| β-strand | 155 | 1 | 6 |
| α-helix | 159-169 | 11 | |
| β-strand | 176-177 | 2 | 5 |
| α-helix | 178-180 | 3 | |
| α-helix | 182-186 | 5 | |
| α-helix | 191-203 | 13 | |
| α-helix | 208-212 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 351-353 | 3 | |
| β-strand | 359-369 | 11 | 7 |
| β-strand | 372-385 | 14 | 7 |
| β-strand | 391-397 | 7 | 7 |
| β-strand | 404-409 | 6 | 7 |
| β-strand | 416-419 | 4 | 7 |
| β-strand | 423-428 | 6 | 7 |
| β-strand | 443-448 | 6 | 7 |
| α-helix | 452-467 | 16 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| GTP-binding nuclear protein Ran | A, C | protein | 217 | Homo sapiens | P62826 (AlphaFold model) |
| Nuclear pore complex protein Nup50 | B, D | protein | 134 | Homo sapiens | Q9UKX7 (AlphaFold model) |
>7MO0_1 GTP-binding nuclear protein Ran (chains A, C) SMAAQGEPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPI KFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVL CGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAM PALAPPEVVMDPALAAQYEHDLEVAQTTALPDEDDDL
>7MO0_2 Nuclear pore complex protein Nup50 (chains B, D) GSDEEENDEPPKVVVTEVKEEDAFYSKKCKLFYKKDNEFKEKGIGTLHLKPTANQKTQLL VRADTNLGNILLNVLIPPNMPCTRTGKNNVLIVCVPNPPIDEKNATMPVTMLIRVKTSED ADELHKILLEKKDA
| ID | Name | Formula | Copies |
|---|---|---|---|
| MG | Magnesium ion | Mg | 2 |
| GNP | Phosphoaminophosphonic acid-guanylate ester | C10 H17 N6 O13 P3 | 2 |
Water and common crystallization additives (SO4) are not listed.
Architecture of the cytoplasmic face of the nuclear pore. Bley, C.J., Nie, S., Mobbs, G.W. et al. Science (2022) 376:eabm9129-eabm9129. DOI 10.1126/science.abm9129 · PubMed
Other PDB entries of the same protein (UniProt P62826 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7MO0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.