7MRN: Mouse CNTN5 APP complex

Mouse CNTN5 APP complex. Determined by X-ray diffraction at 3.5 Å resolution. Released 5 Jan 2022.

Method: X-ray diffraction
Resolution: 3.5 Å
Organism: Mus musculus
Chains: 4
Atoms: 6,326
Mol. weight: 106.25 kDa
Released: 5 Jan 2022

Explore 7MRN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7MRN contains 24 α-helices and 78 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 29 β-strands

Element	Residues	Length	Sheet
α-helix	671-673	3
β-strand	675	1	1
β-strand	676-681	6	2
β-strand	686-690	5	2
β-strand	702-707	6	3
β-strand	716-717	2	3
β-strand	720-721	2	2
β-strand	725-726	2	3
β-strand	731-734	4	2
α-helix	737-738	2
β-strand	742-743	2	4
β-strand	745-750	6	3
β-strand	758	1	3
β-strand	760	1	1
β-strand	765-766	2	4
α-helix	767-769	3
α-helix	775-776	2
β-strand	780-781	2	5
β-strand	788-792	5	5
α-helix	794-797	4
α-helix	798-800	3
β-strand	807-814	8	6
β-strand	820-825	6	6
β-strand	832-836	5	5
α-helix	841	1
β-strand	845-854	10	6
β-strand	857-861	5	6
α-helix	862-864	3
β-strand	865-868	4	6
β-strand	882-885	4	7
β-strand	891-894	4	7
α-helix	904-905	2
β-strand	907-914	8	8
β-strand	923-926	4	8
β-strand	933-936	4	7
α-helix	939-940	2
β-strand	944-952	9	8
β-strand	957	1	8
β-strand	964-967	4	8

Chain B: 8 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	677-682	6	13
β-strand	685-689	5	13
β-strand	702-708	7	14
β-strand	716-717	2	14
β-strand	719-721	3	13
β-strand	725-726	2	14
β-strand	731-735	5	13
α-helix	737-738	2
β-strand	742-743	2	15
β-strand	744-750	7	14
β-strand	758	1	14
β-strand	765-766	2	15
α-helix	767-769	3
α-helix	775-776	2
β-strand	780-782	3	16
β-strand	788-792	5	16
α-helix	794-797	4
α-helix	798-800	3
β-strand	807-814	8	17
β-strand	820-825	6	17
β-strand	832-836	5	16
α-helix	841	1
β-strand	846-854	9	17
β-strand	857-861	5	17
α-helix	862-864	3
β-strand	865-867	3	17
β-strand	882-885	4	18
β-strand	891-894	4	18
β-strand	907-912	6	19
β-strand	925-926	2	19
β-strand	933-936	4	18
α-helix	939-940	2
β-strand	944-952	9	19
β-strand	957	1	19
β-strand	964-967	4	19

Chain C: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	33	1	9
β-strand	44-45	2	10
β-strand	52-53	2	10
α-helix	70-76	7
β-strand	82-87	6	9
β-strand	94	1	11
β-strand	110	1	11
α-helix	114	1
β-strand	115-119	5	9
β-strand	127-129	3	6
β-strand	134-139	6	12
β-strand	145-146	2	12
α-helix	147-160	14
β-strand	164-175	12	12
β-strand	178-187	10	12

Chain D: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	33	1	20
α-helix	70-76	7
β-strand	84-87	4	20
β-strand	92-94	3	21
β-strand	110-112	3	21
β-strand	115-118	4	20
α-helix	124-126	3
β-strand	127-129	3	17
β-strand	134-139	6	22
β-strand	145-146	2	22
α-helix	147-160	14
β-strand	164-175	12	22
β-strand	178-187	10	22

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Contactin-5	A, B	protein	307	Mus musculus	P68500 (AlphaFold model)
N-app	C, D	protein	176	Mus musculus	P12023 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7MRN_1 Contactin-5 (chains A, B)
GSTGSPPGPPGVVIVEEITESTATLSWSPATDNHSPISSYNLQARSPFSLGWQTVKTVPE
VITGDMESAMAVDLNPWVEYEFRVVATNPIGTGDPSIPSRMIRTNEAVPKTAPSNVSGRS
GRRHELVIAWEPVSEEFQNGEGFGYIVAFRPNGTRGWKEKMVTSSEASKFIYRDESVPPL
TPFEVKVGVYNNKGDGPFSQIVVICSAEGEPTAAPTDVTATSVSVSEIFVVWKHVKESLG
RPQGFEISYWKDTEPEDSVETVRTRGNESFVMLTGLEGNTLYHLTVRAYNGAGYGPPSRE
ASTTTKR

Sequence of entity 2 (C, D), FASTA

>7MRN_2 N-APP (chains C, D)
GPGSEVPTDGNAGLLAEPQIAMFCGKLNMHMNVQNGKWESDPSGTKTCIGTKEGILQYCQ
EVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHTHIVIPYRCLVGEFVSDALLVPDKCK
FLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLA

Primary citation

Members of the vertebrate contactin and amyloid precursor protein families interact through a conserved interface. Karuppan, S.J., Vogt, A., Fischer, Z. et al. J Biol Chem (2021) 298:101541-101541. DOI 10.1016/j.jbc.2021.101541 · PubMed

Other PDB entries of the same protein (UniProt P68500 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5E4I 2.6 Å, Crystal structure of mouse CNTN5 Ig1-Ig4 domains

Browse structure collections

About this viewer

MolViewer shows 7MRN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.