7MT1: PDB entry 7MT1

Crystal structure of Human Platelet-activating factor acetylhydrolase IB subunit beta (PAFAH1B1). Determined by X-ray diffraction at 1.3 Å resolution. Released 9 Jun 2021.

Method: X-ray diffraction
Resolution: 1.3 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,822
Mol. weight: 39.11 kDa
Released: 9 Jun 2021

Explore 7MT1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7MT1 contains 5 α-helices and 30 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	96	1	1
α-helix	100	1
β-strand	102-104	3	2
β-strand	111-116	6	3
β-strand	122-127	6	3
β-strand	131-136	6	3
β-strand	142-147	6	3
β-strand	153-158	6	4
β-strand	164-169	6	4
β-strand	174-178	5	4
β-strand	183-188	6	4
β-strand	195-200	6	5
β-strand	206-211	6	5
β-strand	216-220	5	5
β-strand	226-230	5	5
β-strand	237-242	6	6
β-strand	248-253	6	6
β-strand	258-262	5	6
β-strand	268-272	5	6
β-strand	279-284	6	7
α-helix	285-286	2
α-helix	287-289	3
α-helix	290-297	8
β-strand	310-315	6	7
β-strand	320-324	5	7
β-strand	329-334	6	7
β-strand	341-346	6	8
β-strand	353-357	5	8
β-strand	361-366	6	8
α-helix	367-369	3
β-strand	371-377	7	8
β-strand	383-388	6	2
β-strand	394-399	6	2
β-strand	404-408	5	2
β-strand	409	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Platelet-activating factor acetylhydrolase IB subunit beta	A	protein	343	Homo sapiens	P43034 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7MT1_1 Platelet-activating factor acetylhydrolase IB subunit beta (chains A)
MHHHHHHSSGRENLYFQGGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVFSVMVSAS
EDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQGFECIRT
MHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMVRPNQDGT
LIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESSYSSISEATGSETKKSGKP
GPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDY
KNKRCMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWECR

Primary citation

Crystal structure of Human Platelet-activating factor acetylhydrolase IB subunit beta (PAFAH1B1). Hutchinson, A., Seitova, A., Dong, A. et al. To be published.

Other PDB entries of the same protein (UniProt P43034 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9E0Z 2.86 Å, Dimeric motor domains from phi-like dynein-1 bound to a Lis1 dimer under Nde1-Lis1…
9E11 2.86 Å, Dimeric motor domains from phi-like dynein-1 bound to a Lis1 dimer under Lis1 condition
9DZY 3.1 Å, Cryo-EM structure of Pre-Chi dynein bound to Lis1
9E0T 3.1 Å, Cryo-EM structure of human cytoplasmic dynein-1 bound to LIS1 in the presence of ATP
8FDT 3.2 Å, Engineered human dynein motor domain in the microtubule-unbound state with LIS1 complex…
9E0W 3.2 Å, Cryo-EM structure of human cytoplasmic dynein-1 bound to LIS1 in the presence of ATP
8FDU 3.3 Å, Engineered human dynein motor domain in the microtubule-unbound state with LIS1 complex…
9E22 3.3 Å, Cryo-EM structure of human cytoplasmic dynein-1 bound to LIS1 in the presence of ATP
8PQY 3.8 Å, Cytoplasmic dynein-1 motor domain bound to LIS1
9YNC 3.93 Å, Motor domains of phi-like human dynein-1 bound to dynactin-p150glued and LIS1
8DYV 3.97 Å, Structure of human cytoplasmic dynein-1 bound to one Lis1
8DYU 4.0 Å, Structure of human cytoplasmic dynein-1 bound to two Lis1 proteins

Browse structure collections

About this viewer

MolViewer shows 7MT1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.