ER-PRS*(+) (Y537S) in complex with genistein and SRC-2 coactivator peptide. Determined by X-ray diffraction at 1.33 Å resolution. Released 25 Aug 2021.
Explore 7NFB in 3D Show helices and sheets RCSB PDB PDBe
7NFB contains 27 α-helices and 4 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 307-309 | 3 | |
| α-helix | 312-321 | 10 | |
| α-helix | 323-325 | 3 | |
| α-helix | 327-329 | 3 | |
| α-helix | 339-363 | 25 | |
| α-helix | 367-369 | 3 | |
| α-helix | 372-395 | 24 | |
| β-strand | 402-405 | 4 | 1 |
| β-strand | 408-410 | 3 | 1 |
| α-helix | 412-415 | 4 | |
| α-helix | 421-438 | 18 | |
| α-helix | 442-455 | 14 | |
| α-helix | 466-492 | 27 | |
| α-helix | 497-530 | 34 | |
| α-helix | 538-545 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 307-309 | 3 | |
| α-helix | 312-321 | 10 | |
| α-helix | 323-325 | 3 | |
| α-helix | 339-361 | 23 | |
| α-helix | 367-369 | 3 | |
| α-helix | 372-395 | 24 | |
| β-strand | 401-405 | 5 | 2 |
| β-strand | 408-411 | 4 | 2 |
| α-helix | 412-415 | 4 | |
| α-helix | 421-438 | 18 | |
| α-helix | 442-455 | 14 | |
| α-helix | 466-492 | 27 | |
| α-helix | 497-530 | 34 | |
| α-helix | 538-545 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 689-693 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 689-695 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Estrogen receptor | A, B | protein | 247 | Homo sapiens | P03372 (AlphaFold model) |
| Nuclear receptor coactivator 2 | C, D | protein | 15 | Homo sapiens | Q15596 (AlphaFold model) |
>7NFB_1 Estrogen receptor (chains A, B) SMNSLALSLTADQIISALLEAEPPILYSEYDPSRPFSEAYMMGLLTNLADRELVHMINWA KKVPGFVDLSLHDQVHLLESAWLEILMIGLVWRSMDHPGKLLFAPDLLLDREQGKSVEGM VEIFDMLLATSERFREMKLQREEFVCLKAIILLNSGVYTFLSSTLKSLENKEKIHRMLDK ITDALIWYMAKSGLSLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKSKNVVPLSDLLL EMLDAHR
>7NFB_2 Nuclear receptor coactivator 2 (chains C, D) XKHKILHRLLQDSSS
| ID | Name | Formula | Copies |
|---|---|---|---|
| GEN | Genistein | C15 H10 O5 | 2 |
Water and common crystallization additives (NA, EDO, CL, GOL) are not listed.
A PROSS-designed extensively mutated estrogen receptor alpha variant displays enhanced thermal stability while retaining native allosteric regulation and structure. Kriegel, M., Wiederanders, H.J., Alkhashrom, S. et al. Sci Rep (2021) 11:10509-10509. DOI 10.1038/s41598-021-89785-1 · PubMed
Other PDB entries of the same protein (UniProt P03372 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7NFB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.