7NK0: BIR1 domain of cIAP2

Structure of the BIR1 domain of cIAP2. Determined by X-ray diffraction at 3.3 Å resolution. Released 12 Jan 2022.

Method: X-ray diffraction
Resolution: 3.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,130
Mol. weight: 22.24 kDa
Ligands: ZN
Released: 12 Jan 2022

Explore 7NK0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7NK0 contains 8 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain D: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	39-40	2
α-helix	47-53	7
β-strand	55-57	3	1
β-strand	64-66	3	1
β-strand	72-73	2	1
α-helix	82-89	8

Chain E: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	29-33	5
α-helix	34-36	3
α-helix	47-52	6
β-strand	55-57	3	2
β-strand	64-66	3	2
β-strand	72-73	2	2
α-helix	82-89	8
α-helix	94-96	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Baculoviral IAP repeat-containing protein 3	D, E	protein	98	Homo sapiens	Q13489 (AlphaFold model)

Sequence of entity 1 (D, E), FASTA

>7NK0_1 Baculoviral IAP repeat-containing protein 3 (chains D, E)
MGSSHHHHHHSSGLVPRGSHMLSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGVNDKV
KCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQSLNSV

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Structure-based identification of a new IAP-targeting compound that induces cancer cell death inducing NF-kappa B pathway. Cossu, F., Camelliti, S., Lecis, D. et al. Comput Struct Biotechnol J (2021) 19:6366-6374. DOI 10.1016/j.csbj.2021.11.034 · PubMed

Other PDB entries of the same protein (UniProt Q13489 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2UVL 1.91 Å, Human BIR3 domain of Baculoviral Inhibitor of Apoptosis Repeat- Containing 3 (BIRC3)
3EB5 2.0 Å, Structure of the cIAP2 RING domain
3M0A 2.61 Å, Crystal structure of TRAF2:cIAP2 complex
3M0D 2.8 Å, Crystal structure of the TRAF1:TRAF2:cIAP2 complex
3EB6 3.4 Å, Structure of the cIAP2 RING domain bound to UbcH5b

Browse structure collections

About this viewer

MolViewer shows 7NK0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.