7NMZ: 14-3-3 eta

Structure of 14-3-3 eta in complex with Nedd4-2(335-455) containing two 14-3-3 binding motifs Ser342 and Ser448. Determined by X-ray diffraction at 2.3 Å resolution. Released 21 Jul 2021.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 3
Atoms: 3,907
Mol. weight: 67.82 kDa
Released: 21 Jul 2021

Explore 7NMZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7NMZ contains 26 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain AA: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	5-18	14
α-helix	22-33	12
α-helix	41-75	35
α-helix	78-105	28
α-helix	106-110	5
α-helix	111-113	3
α-helix	119-137	19
α-helix	142-166	25
α-helix	172-183	12
α-helix	184-188	5
α-helix	192-207	16
α-helix	210-212	3
α-helix	215-235	21

Chain BA: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	6-18	13
α-helix	22-33	12
α-helix	37-39	3
α-helix	41-74	34
α-helix	78-105	28
α-helix	106-110	5
α-helix	119-138	20
α-helix	142-166	25
α-helix	172-183	12
α-helix	184-188	5
α-helix	192-208	17
α-helix	218-235	18

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	445-450	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
14-3-3 protein eta	AA, BA	protein	236	Homo sapiens	Q04917 (AlphaFold model)
E3 ubiquitin-protein ligase NEDD4-like	C	protein	125	Homo sapiens	Q96PU5 (AlphaFold model)

Sequence of entity 1 (AA, BA), FASTA

>7NMZ_1 14-3-3 protein eta (chains AA, BA)
GHMGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRS
SWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYE
SKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALN
FSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWT

Sequence of entity 2 (C), FASTA

>7NMZ_2 E3 ubiquitin-protein ligase NEDD4-like (chains C)
GAMGSSRLRSCSVTDAVAEQGHLPPPSAPAGRARSSAVTGGEEPTPSVAYVHTTPGLPSG
WEERKDAKGRTYYVNHNNRTTTWTRPIMQLAEDGASGSATNSNNHLIEPQIRRPRSLSSP
TVTLS

Primary citation

14-3-3-protein regulates Nedd4-2 by modulating interactions between HECT and WW domains. Pohl, P., Joshi, R., Petrvalska, O. et al. Commun Biol (2021) 4:899-899. DOI 10.1038/s42003-021-02419-0 · PubMed

Other PDB entries of the same protein (UniProt Q04917 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2C63 2.15 Å, 14-3-3 Protein Eta (Human) Complexed to Peptide
2C74 2.7 Å, 14-3-3 Protein Eta (Human) Complexed to Peptide
9R2I 3.3 Å, Cryo-EM structure of the complex CDK16:CCNY:14-3-3
9R2N 3.83 Å, Cryo-EM structure of the complex CCNY:14-3-3

Browse structure collections

About this viewer

MolViewer shows 7NMZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.