Mutant H493A of SH3 domain of JNK-interacting Protein 1 (JIP1). Determined by X-ray diffraction at 1.95 Å resolution. Released 22 Dec 2021.
Explore 7NYL in 3D Show helices and sheets RCSB PDB PDBe
7NYL contains 2 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 492-495 | 4 | 1 |
| β-strand | 499 | 1 | 2 |
| β-strand | 506 | 1 | 1 |
| β-strand | 509 | 1 | 2 |
| β-strand | 514-520 | 7 | 1 |
| β-strand | 525-530 | 6 | 1 |
| β-strand | 536-540 | 5 | 1 |
| α-helix | 541-543 | 3 | |
| β-strand | 544-547 | 4 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 491-495 | 5 | 3 |
| β-strand | 499 | 1 | 4 |
| β-strand | 506 | 1 | 3 |
| β-strand | 509 | 1 | 4 |
| β-strand | 514-520 | 7 | 3 |
| β-strand | 525-530 | 6 | 3 |
| β-strand | 536-540 | 5 | 3 |
| α-helix | 541-543 | 3 | |
| β-strand | 544-546 | 3 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| SH3 domain of JNK-interacting Protein 1 (JIP1) | AAA, BBB | protein | 63 | Homo sapiens | Q9UQF2 (AlphaFold model) |
>7NYL_1 SH3 domain of JNK-interacting Protein 1 (JIP1) (chains AAA, BBB) GHMEQTARAIFRFVPRHEDELELEVDDPLLVELQAEDYWYEAYNMRTGARGVFPAYYAIE VTK
Visualizing protein breathing motions associated with aromatic ring flipping. Marino Perez, L., Ielasi, F.S., Bessa, L.M. et al. Nature (2022) 602:695-700. DOI 10.1038/s41586-022-04417-6 · PubMed
Other PDB entries of the same protein (UniProt Q9UQF2 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7NYL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.