7NZC: First SH3 domain of POSH

First SH3 domain of POSH (Plenty of SH3 Domains protein). Determined by X-ray diffraction at 1.11 Å resolution. Released 22 Dec 2021.

Method: X-ray diffraction
Resolution: 1.11 Å
Organism: Homo sapiens
Chains: 1
Atoms: 684
Mol. weight: 7.54 kDa
Released: 22 Dec 2021

Explore 7NZC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7NZC contains 3 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain AAA: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	135-137	3
β-strand	138-141	4	1
β-strand	145	1	2
β-strand	152	1	1
α-helix	153-154	2
β-strand	155	1	2
β-strand	160-168	9	1
β-strand	171-176	6	1
β-strand	179-184	6	1
α-helix	185-187	3
β-strand	188-192	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase SH3RF1	AAA	protein	63	Homo sapiens	Q7Z6J0 (AlphaFold model)

Sequence of entity 1 (AAA), FASTA

>7NZC_1 E3 ubiquitin-protein ligase SH3RF1 (chains AAA)
GRRQLPCAKALYNYEGKEPGDLKFSKGDIIILRRQVDENWYHGEVNGIHGFFPTNFVQII
KPL

Primary citation

Visualizing protein breathing motions associated with aromatic ring flipping. Marino Perez, L., Ielasi, F.S., Bessa, L.M. et al. Nature (2022) 602:695-700. DOI 10.1038/s41586-022-04417-6 · PubMed

Other PDB entries of the same protein (UniProt Q7Z6J0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9RFF 1.25 Å, Crystal Structure of Human Rac1 Fused with the Scaffold Protein POSH (residues 319-371)
7NZD 1.45 Å, Fourth SH3 domain of POSH (Plenty of SH3 Domains protein)
9TJY 1.77 Å, Crystal Structure of the Human Oncogenic Splice Variant Rac1b Fused with the Scaffold…
9RFB 1.85 Å, Crystal Structure of Human Rac1 in Complex with the Scaffold Protein POSH (residues…

Browse structure collections

About this viewer

MolViewer shows 7NZC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.