7O9H: Escherichia coli FtsY

Escherichia coli FtsY in complex with pppGpp. Determined by X-ray diffraction at 2.4 Å resolution. Released 2 Feb 2022.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Escherichia coli DH5[alpha]
Chains: 2
Atoms: 4,808
Mol. weight: 69.96 kDa
Ligands: 0O2
Released: 2 Feb 2022

Explore 7O9H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7O9H contains 35 α-helices and 21 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	196-202	7
α-helix	204-207	4
α-helix	211-214	4
α-helix	215-218	4
β-strand	222	1	1
α-helix	225-237	13
α-helix	242-258	17
β-strand	263	1	1
α-helix	264-266	3
α-helix	267-280	14
β-strand	294-299	6	2
α-helix	306-319	14
β-strand	324-329	6	2
α-helix	334-347	14
β-strand	351-352	2	2
α-helix	360-373	14
β-strand	378-383	6	2
α-helix	389-391	3
α-helix	393-405	13
β-strand	414-420	7	2
α-helix	421-423	3
α-helix	426-438	13
β-strand	442-446	5	2
α-helix	456-464	9
β-strand	468-472	5	2
α-helix	477-479	3
β-strand	480-482	3	2
α-helix	485-493	9

Chain B: 17 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	196-202	7
α-helix	206-208	3
α-helix	211-214	4
α-helix	215-218	4
β-strand	222	1	3
α-helix	225-237	13
α-helix	242-258	17
β-strand	263	1	3
α-helix	264-266	3
α-helix	267-280	14
β-strand	283	1	4
β-strand	294-299	6	4
α-helix	306-319	14
β-strand	324-327	4	4
α-helix	334-347	14
β-strand	351-352	2	4
α-helix	360-373	14
β-strand	378-381	4	4
α-helix	390-407	18
β-strand	414-420	7	4
α-helix	421-423	3
α-helix	425-438	14
β-strand	442-446	5	4
α-helix	456-464	9
β-strand	468-472	5	4
α-helix	477-479	3
β-strand	480-482	3	4
α-helix	485-493	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Signal recognition particle receptor FtsY	A, B	protein	312	Escherichia coli DH5[alpha]	P10121 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7O9H_1 Signal recognition particle receptor FtsY (chains A, B)
MGGFFARLKRSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITN
LTEGASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVEGKTPFVILMVGVNGVGKTTTIG
KLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAA
KARNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQA
KLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEA
LFAREDHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
0O2	guanosine 5'-(tetrahydrogen triphosphate) 3'-(trihydrogen diphosphate)	C10 H18 N5 O20 P5	2

Primary citation

Inhibition of SRP-dependent protein secretion by the bacterial alarmone (p)ppGpp. Czech, L., Mais, C.N., Kratzat, H. et al. Nat Commun (2022) 13:1069-1069. DOI 10.1038/s41467-022-28675-0 · PubMed

Other PDB entries of the same protein (UniProt P10121 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6N9B 1.22 Å, FtsY-NG ultra high-resolution
6N5J 1.37 Å, FtsY-NG high-resolution
6CQP 1.45 Å, High resolution crystal structure of FtsY-NG domain of E. coli
6N5I 1.5 Å, FtsY-NG high-resolution
6NC1 1.6 Å, FtsY-NG high-resolution
2YHS 1.6 Å, Structure of the E. coli SRP receptor FtsY
6NC4 1.6 Å, FtsY-NG high-resolution
5NIY 1.7 Å, Signal recognition particle-docking protein FtsY
6CS8 1.75 Å, High resolution crystal structure of FtsY-NG domain of E. coli
6CVD 1.78 Å, High resolution crystal structure of FtsY-NG domain of E. coli bound to fragment 1
6DLX 1.85 Å, FtsY-NG domain bound to fragment 3.
6N6N 1.88 Å, FtsY-NG high-resolution

Browse structure collections

About this viewer

MolViewer shows 7O9H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.