7O9I: Escherichia coli Ffh

Escherichia coli Ffh in complex with pppGpp. Determined by X-ray diffraction at 2.49 Å resolution. Released 2 Feb 2022.

Method: X-ray diffraction
Resolution: 2.49 Å
Organism: Escherichia coli (strain K12)
Chains: 1
Atoms: 2,206
Mol. weight: 34.08 kDa
Ligands: 0O2
Released: 2 Feb 2022

Explore 7O9I in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7O9I contains 16 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	10-16	7
α-helix	25-37	13
α-helix	38-42	5
α-helix	48-62	15
α-helix	64-66	3
α-helix	70-85	16
β-strand	101-106	6	1
α-helix	113-126	14
β-strand	132-136	5	1
α-helix	144-155	12
β-strand	158-159	2	1
α-helix	168-181	14
β-strand	186-190	5	1
α-helix	199-212	14
β-strand	216-222	7	1
α-helix	223-225	3
α-helix	227-239	13
β-strand	244-248	5	1
α-helix	250-252	3
α-helix	258-266	9
α-helix	268-269	2
β-strand	270-274	5	1
β-strand	282-284	3	1
α-helix	287-293	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Signal recognition particle protein	A	protein	306	Escherichia coli (strain K12)	P0AGD7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7O9I_1 Signal recognition particle protein (chains A)
MGFDNLTDRLSRTLRNISGRGRLTEDNVKDTLREVRMALLEADVALPVVREFINRVKEKA
VGHEVNKSLTPGQEFVKIVRNELVAAMGEENQTLNLAAQPPAVVLMAGLQGAGKTTSVGK
LGKFLREKHKKKVLVVSADVYRPAAIKQLETLAEQVGVDFFPSDVGQKPVDIVNAALKEA
KLKFYDVLLVDTAGRLHVDEAMMDEIKQVHASINPVETLFVVDAMTGQDAANTAKAFNEA
LPLTGVVLTKVDGDARGGAALSIRHITGKPIKFLGVGEKTEALEPFHPDRIASRILGMGD
HHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
0O2	guanosine 5'-(tetrahydrogen triphosphate) 3'-(trihydrogen diphosphate)	C10 H18 N5 O20 P5	1

Primary citation

Inhibition of SRP-dependent protein secretion by the bacterial alarmone (p)ppGpp. Czech, L., Mais, C.N., Kratzat, H. et al. Nat Commun (2022) 13:1069-1069. DOI 10.1038/s41467-022-28675-0 · PubMed

Other PDB entries of the same protein (UniProt P0AGD7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1HQ1 1.52 Å, Structural and energetic analysis of RNA recognition by a universally conserved protein…
1DUL 1.8 Å, Structure of the ribonucleoprotein core of the E. Coli signal recognition particle
3LQX 1.93 Å, SRP ribonucleoprotein core complexed with cobalt hexammine
2PXD 2.0 Å, Variant 1 of Ribonucleoprotein Core of the E. Coli Signal Recognition Particle
2PXE 2.0 Å, Variant 4 of Ribonucleoprotein Core of the E. Coli Signal Recognition Particle
2PXF 2.0 Å, Variant 5 of Ribonucleoprotein Core of the E. Coli Signal Recognition Particle
2PXV 2.0 Å, Variant 6 of Ribonucleoprotein Core of the E. Coli Signal Recognition Particle
2PXB 2.5 Å, Variant 2 of Ribonucleoprotein Core of the E. Coli Signal Recognition Particle
2PXK 2.5 Å, Variant 8 of Ribonucleoprotein Core of the E. Coli Signal Recognition Particle
2PXL 2.5 Å, Variant 9 of Ribonucleoprotein Core of the E. Coli Signal Recognition Particle
2PXP 2.5 Å, Variant 13 of Ribonucleoprotein Core of the E. Coli Signal Recognition Particle
2PXQ 2.5 Å, Variant 14 of Ribonucleoprotein Core of the E. Coli Signal Recognition Particle

Browse structure collections

About this viewer

MolViewer shows 7O9I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.