7OCC: NTD of resting state GluA1/A2 heterotertramer

NTD of resting state GluA1/A2 heterotertramer. Determined by electron microscopy at 3.4 Å resolution. Released 9 Jun 2021.

Method: Electron microscopy
Resolution: 3.4 Å
Organism: Rattus norvegicus
Chains: 4
Atoms: 11,202
Mol. weight: 402.02 kDa
Ligands: NAG
Released: 9 Jun 2021

Explore 7OCC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7OCC contains 50 α-helices and 76 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 12 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	6-8	3	1
β-strand	9	1	2
β-strand	11-13	3	3
α-helix	19-29	11
β-strand	36-38	3	1
β-strand	41-43	3	3
α-helix	49-62	14
β-strand	66	1	2
β-strand	67-68	2	4
β-strand	69	1	3
α-helix	73-85	13
β-strand	90-92	3	4
β-strand	104-106	3	4
α-helix	112-121	10
β-strand	126-131	6	5
α-helix	137-150	14
β-strand	153-158	6	5
α-helix	164-175	12
β-strand	180-185	6	5
α-helix	188-200	13
β-strand	208-213	6	5
α-helix	223-225	3
β-strand	231-236	6	5
α-helix	243-258	16
α-helix	270-292	23
α-helix	311-313	3
α-helix	316-325	10
β-strand	328-329	2	6
β-strand	334-335	2	6
β-strand	342	1	4
β-strand	347-354	8	5
β-strand	357-365	9	5
β-strand	371-372	2	5

Chains B and D: 13 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	5-13	9	7
α-helix	17-30	14
β-strand	36-44	9	7
α-helix	49-61	13
β-strand	66-68	3	7
α-helix	76-86	11
β-strand	89-92	4	7
α-helix	95-97	3
β-strand	105-106	2	7
α-helix	109-110	2
α-helix	112-121	10
β-strand	126-131	6	8
α-helix	138-150	13
β-strand	153-158	6	8
α-helix	167-180	14
β-strand	185-189	5	8
α-helix	192-202	11
β-strand	213-216	4	8
β-strand	235-240	6	8
α-helix	247-257	11
α-helix	274-296	23
α-helix	314	1
α-helix	320-328	9
β-strand	332-333	2	9
β-strand	338-339	2	9
β-strand	340-341	2	10
β-strand	347-348	2	10
β-strand	353-358	6	8
β-strand	361-368	8	8
β-strand	374-376	3	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glutamate receptor 1	A, C	protein	915	Rattus norvegicus	P19490 (AlphaFold model)
Glutamate receptor 2	B, D	protein	860	Rattus norvegicus	P19491 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>7OCC_1 Glutamate receptor 1 (chains A, C)
MPYIFAFFCTGFLGAVVGADYKDDDDKNFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEP
PKLLPQIDIVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPS
FPVDTSNQFVLQLRPELQEALISIIDHYKWQTFVYIYDADRGLSVLQRVLDTAAEKNWQV
TAVNILTTTEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIVKLEKNGIGYHYILAN
LGFMDIDLNKFKESGANVTGFQLVNYTDTIPARIMQQWRTSDSRDHTRVDWKRPKYTSAL
TYDGVKVMAEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGN
VQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVT
TILEDPYVMLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTK
AWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL
DPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLW
FSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAED
LAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKG
KYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGV
LDKLKSKWWYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKS
RSESKRMKGFCLIPQQSINEAIRTSTLPRNSGAGASGGGGSGENGRVVSQDFPKSMQSIP
CMSHSSGMPLGATGL

Sequence of entity 2 (B, D), FASTA

>7OCC_2 Glutamate receptor 2 (chains B, D)
MQKIMHISVLLSPVLWGLIFGVSSNSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTP
HIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDG
THPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINV
GNINNDKKDETYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANL
GFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTATIKYTSALT
YDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNI
KFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTT
ILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKI
WNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLD
PLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWF
SLGAFMRQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDL
SKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGK
YAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGTPVNLAVLKLSEQGVL
DKLKNKWWYDKGECGAKDSGSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSR
AEAKRMKVAKNPQNINPSSS

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	6

Primary citation

Gating and modulation of a hetero-octameric AMPA glutamate receptor. Zhang, D., Watson, J.F., Matthews, P.M. et al. Nature (2021) 594:454-458. DOI 10.1038/s41586-021-03613-0 · PubMed

Other PDB entries of the same protein (UniProt P19490 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2AWW 2.21 Å, Synapse associated protein 97 PDZ2 domain variant C378G with C-terminal GluR-A peptide
3SAJ 2.5 Å, Crystal Structure of glutamate receptor GluA1 Amino Terminal Domain
8C2H 2.64 Å, Transmembrane domain of active state homomeric GluA1 AMPA receptor in tandem with TARP…
8C2I 2.7 Å, Transmembrane domain of resting state homomeric GluA1 AMPA receptor in complex with TARP…
8AYN 2.8 Å, Resting state GluA1/A2 AMPA receptor in complex with TARP gamma 8 and ligand LY3130481
8C1Q 2.82 Å, Resting state homomeric GluA1 AMPA receptor in complex with TARP gamma 3
8C1P 2.9 Å, Active state homomeric GluA1 AMPA receptor in complex with TARP gamma 3
7OCE 3.1 Å, Resting state GluA1/A2 AMPA receptor in complex with TARP gamma 8 and CNIH2 (LBD-TMD)
8AYL 3.2 Å, Resting state GluA1/A2 AMPA receptor in complex with TARP gamma 8 and ligand JNJ-61432059
9OVU 3.2 Å, Composite map of GluA1/A2 in the activated state, in complex with positive allosteric…
9NR6 3.26 Å, The structure of Noelin 1 with cerebellar GluA1/A4-ATD
8AYM 3.3 Å, Resting state GluA1/A2 AMPA receptor in complex with TARP gamma 8 and ligand JNJ-55511118

Browse structure collections

About this viewer

MolViewer shows 7OCC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.