Crystal structure of bovine Hsc70(aa1-554)E213A/D214A in complex with methanesulfonamide. Determined by X-ray diffraction at 1.83 Å resolution. Released 1 Jun 2022.
Explore 7ODI in 3D Show helices and sheets RCSB PDB PDBe
7ODI contains 23 α-helices and 32 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7-11 | 5 | 1 |
| β-strand | 15-22 | 8 | 1 |
| β-strand | 25-28 | 4 | 1 |
| α-helix | 29-30 | 2 | |
| β-strand | 38-39 | 2 | 1 |
| β-strand | 42-44 | 3 | 2 |
| β-strand | 49-51 | 3 | 2 |
| α-helix | 53-57 | 5 | |
| β-strand | 66-67 | 2 | 2 |
| α-helix | 70-73 | 4 | |
| α-helix | 81-89 | 9 | |
| β-strand | 93-97 | 5 | 3 |
| β-strand | 100-107 | 8 | 3 |
| β-strand | 110-114 | 5 | 3 |
| α-helix | 116-135 | 20 | |
| β-strand | 141-146 | 6 | 1 |
| α-helix | 152-164 | 13 | |
| β-strand | 168-174 | 7 | 1 |
| α-helix | 175-182 | 8 | |
| α-helix | 185-187 | 3 | |
| β-strand | 193-200 | 8 | 4 |
| β-strand | 205-213 | 9 | 4 |
| β-strand | 216-225 | 10 | 4 |
| α-helix | 230-249 | 20 | |
| α-helix | 253-255 | 3 | |
| α-helix | 257-276 | 20 | |
| β-strand | 279-288 | 10 | 5 |
| β-strand | 291-298 | 8 | 5 |
| α-helix | 299-305 | 7 | |
| α-helix | 307-312 | 6 | |
| α-helix | 314-323 | 10 | |
| α-helix | 328-330 | 3 | |
| β-strand | 333-337 | 5 | 4 |
| α-helix | 339-342 | 4 | |
| α-helix | 344-353 | 10 | |
| β-strand | 360 | 1 | 4 |
| α-helix | 368-381 | 14 | |
| β-strand | 396 | 1 | 6 |
| β-strand | 401-405 | 5 | 7 |
| β-strand | 409-414 | 6 | 7 |
| β-strand | 419 | 1 | 6 |
| β-strand | 422-428 | 7 | 8 |
| β-strand | 429-430 | 2 | 9 |
| β-strand | 438-444 | 7 | 7 |
| β-strand | 449 | 1 | 7 |
| α-helix | 450-452 | 3 | |
| β-strand | 454-461 | 8 | 7 |
| α-helix | 464-466 | 3 | |
| β-strand | 474-480 | 7 | 8 |
| β-strand | 486-492 | 7 | 8 |
| β-strand | 498-503 | 6 | 8 |
| α-helix | 512-524 | 13 | |
| α-helix | 526-535 | 10 | |
| β-strand | 541-542 | 2 | 9 |
| α-helix | 547-549 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Heat shock cognate 71 kDa protein | A | protein | 554 | Bos taurus | P19120 (AlphaFold model) |
>7ODI_1 Heat shock cognate 71 kDa protein (chains A) MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA MNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVS SMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAA IAYGLDKKVGAERNVLIFDLGGGTFDVSILTIAAGIFEVKSTAGDTHLGGEDFDNRMVNH FIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRA RFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELN KSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDI DANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKN SLESYAFNMKATVE
| ID | Name | Formula | Copies |
|---|---|---|---|
| V7Z | methanesulfonamide | C H5 N O2 S | 2 |
Water and common crystallization additives (EPE, GOL, NA) are not listed.
Combined In-Solution Fragment Screening and Crystallographic Binding-Mode Analysis with a Two-Domain Hsp70 Construct. Zehe, M., Kehrein, J., Schollmayer, C. et al. ACS Chem Biol (2024). DOI 10.1021/acschembio.3c00589 · PubMed
Other PDB entries of the same protein (UniProt P19120 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7ODI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.