7OFV: Ephrin type-A receptor 4

NMR-guided design of potent and selective EphA4 agonistic ligands. Determined by X-ray diffraction at 1.43 Å resolution. Released 11 Aug 2021.

Method: X-ray diffraction
Resolution: 1.43 Å
Organisms: Homo sapiens, synthetic construct
Chains: 2
Atoms: 1,894
Mol. weight: 22.28 kDa
Released: 11 Aug 2021

Explore 7OFV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7OFV contains 4 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	29-35	7	1
α-helix	36-38	3
β-strand	46-48	3	2
β-strand	55-60	6	1
β-strand	66-72	7	1
β-strand	82-85	4	2
β-strand	89-90	2	2
β-strand	97-105	9	1
α-helix	108-110	3
β-strand	119	1	3
β-strand	121-129	9	2
α-helix	139-141	3
β-strand	143-149	7	2
β-strand	154-159	6	1
β-strand	162-173	12	1
β-strand	180-187	8	2
β-strand	190	1	3
β-strand	192-203	12	1
α-helix	204-207	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ephrin type-A receptor 4	A	protein	185	Homo sapiens	P54764 (AlphaFold model)
EphA4 agonist ligand	B	protein	6	synthetic construct

Sequence of entity 1 (A), FASTA

>7OFV_1 Ephrin type-A receptor 4 (chains A)
GSHMNEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWL
RTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVK
IDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKA
PLTVR

Sequence of entity 2 (B), FASTA

>7OFV_2 EphA4 agonist ligand (chains B)
XXFRGX

Primary citation

NMR-Guided Design of Potent and Selective EphA4 Agonistic Ligands. Baggio, C., Kulinich, A., Dennys, C.N. et al. J Med Chem (2021) 64:11229-11246. DOI 10.1021/acs.jmedchem.1c00608 · PubMed

Other PDB entries of the same protein (UniProt P54764 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5JR2 1.75 Å, Crystal structure of the EphA4 LBD in complex with APYd3 peptide inhibitor
2WO1 1.85 Å, Crystal Structure of the EphA4 Ligand Binding Domain
4M4P 2.08 Å, Crystal structure of EPHA4 ectodomain
2WO3 2.35 Å, Crystal Structure of the EphA4-ephrinA2 complex
4W4Z 2.41 Å, Structure of the EphA4 LBD in complex with peptide
4W50 2.42 Å, Structure of the EphA4 LBD in complex with peptide
2WO2 2.45 Å, Crystal Structure of the EphA4-ephrinB2 complex
3GXU 2.5 Å, Crystal structure of Eph receptor and ephrin complex
9CY8 2.5 Å, Constrained b-hairpins targeting the EphA4 ligand binding domain
3CKH 2.8 Å, Crystal structure of Eph A4 receptor
4M4R 3.13 Å, Epha4 ectodomain complex with ephrin a5
4BK4 3.65 Å, crystal structure of the human EphA4 ectodomain

Browse structure collections

About this viewer

MolViewer shows 7OFV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.