7OJ9: SNX9 SH3 - EEEV nsP3 peptide complex

NMR solution structure of SNX9 SH3 - EEEV nsP3 peptide complex. Determined by solution NMR. Released 13 Apr 2022.

Method: Solution NMR
Organisms: Eastern equine encephalitis virus, Homo sapiens
Chains: 2
Atoms: 684
Mol. weight: 9.73 kDa
Released: 13 Apr 2022

Explore 7OJ9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7OJ9 contains 3 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
β-strand	11	1	2
β-strand	19	1	1
β-strand	22	1	2
β-strand	27-32	6	1
β-strand	39-43	5	1
β-strand	49-53	5	1
α-helix	54-56	3
β-strand	57-59	3	1
α-helix	60-61	2

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	1671-1674	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
EEEV nsP3 peptide	B	protein	23	Eastern equine encephalitis virus	Q306W6
Sorting nexin-9	A	protein	67	Homo sapiens	Q9Y5X1 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>7OJ9_1 EEEV nsP3 peptide (chains B)
AERLIPRRPAPPVPVPARIPSPR

Sequence of entity 2 (A), FASTA

>7OJ9_2 Sorting nexin-9 (chains A)
GSHMATKARVMYDFAAEPGNNELTVNEGEIITITNPDVGGGWLEGRNIKGERGLVPTDYV
EILPSDG

Primary citation

Structure of SNX9 SH3 in complex with a viral ligand reveals the molecular basis of its unique specificity for alanine-containing class I SH3 motifs. Tossavainen, H., Ugurlu, H., Karjalainen, M. et al. Structure (2022) 30:828. DOI 10.1016/j.str.2022.03.006 · PubMed

Browse structure collections

About this viewer

MolViewer shows 7OJ9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.