7OK6: UNC119B

Crystal structure of UNC119B in complex with LCK peptide. Determined by X-ray diffraction at 1.95 Å resolution. Released 9 Jun 2021.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,140
Mol. weight: 48.51 kDa
Ligands: CA, MYR
Released: 9 Jun 2021

Explore 7OK6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7OK6 contains 9 α-helices and 19 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain AAA: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	62-66	5
α-helix	79-81	3
β-strand	87-95	9	3
β-strand	101-106	6	3
β-strand	120-124	5	4
β-strand	128-132	5	4
α-helix	135-139	5
β-strand	142-150	9	3
β-strand	160-167	8	4
β-strand	170-178	9	4
β-strand	187-195	9	3
α-helix	201-209	9
β-strand	214-222	9	4
β-strand	225-235	11	4

Chain HHH: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	62-66	5
α-helix	79-81	3
β-strand	87-95	9	1
β-strand	101-106	6	1
β-strand	128-132	5	2
α-helix	135-139	5
β-strand	142-150	9	1
β-strand	156-167	12	2
β-strand	170-182	13	2
β-strand	187-195	9	1
α-helix	196-198	3
α-helix	201-209	9
β-strand	214-222	9	2
β-strand	225-235	11	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein unc-119 homolog B	AAA, HHH	protein	194	Homo sapiens	A6NIH7 (AlphaFold model)
LCK peptide	BBB, CCC	protein	10	Homo sapiens

Sequence of entity 1 (AAA, HHH), FASTA

>7OK6_1 Protein unc-119 homolog B (chains AAA, HHH)
DTIRPEHVLRLSRVTENYLCKPEDNIYSIDFTRFKIRDLETGTVLFEIAKPCVSDQEEDE
EEGGGDVDISAGRFVRYQFTPAFLRLRTVGATVEFTVGDKPVSNFRMIERHYFREHLLKN
FDFDFGFCIPSSRNTCEHIYEFPQLSEDVIRLMIENPYETRSDSFYFVDNKLIMHNKADY
AYNGGQLEHHHHHH

Sequence of entity 2 (BBB, CCC), FASTA

>7OK6_2 LCK peptide (chains BBB, CCC)
GCGCSSHPED

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1
MYR	Myristic acid	C14 H28 O2	2

Water and common crystallization additives (EDO) are not listed.

Primary citation

The Structural and Biochemical Characterization of UNC119B Cargo Binding and Release Mechanisms. Yelland, T., Garcia, E., Samarakoon, Y. et al. Biochemistry (2021) 60:1952-1963. DOI 10.1021/acs.biochem.1c00251 · PubMed

Other PDB entries of the same protein (UniProt A6NIH7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7OK7 3.15 Å, Crystal structure of the UNC119B ARL3 complex

Browse structure collections

About this viewer

MolViewer shows 7OK6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.