7OK7: UNC119B ARL3 complex

Crystal structure of the UNC119B ARL3 complex. Determined by X-ray diffraction at 3.15 Å resolution. Released 9 Jun 2021.

Method: X-ray diffraction
Resolution: 3.15 Å
Organisms: Mus musculus, Homo sapiens
Chains: 12
Atoms: 17,127
Mol. weight: 258.37 kDa
Ligands: GNP, MG, PO4
Released: 9 Jun 2021

Explore 7OK7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7OK7 contains 89 α-helices and 92 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	17-23	7	1
α-helix	30-37	8
β-strand	51-58	8	1
β-strand	61-68	8	1
α-helix	75-81	7
β-strand	87-93	7	1
α-helix	97-99	3
α-helix	100-112	13
α-helix	114-116	3
β-strand	121-126	6	1
α-helix	133-135	3
α-helix	136-143	8
α-helix	145-147	3
β-strand	153-157	5	1
α-helix	166-175	10

Chain B: 10 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	17-23	7	2
α-helix	30-37	8
β-strand	51-58	8	2
β-strand	61-68	8	2
α-helix	75-81	7
β-strand	87-93	7	2
α-helix	97-99	3
α-helix	100-110	11
α-helix	114-116	3
β-strand	121-126	6	2
α-helix	133-135	3
α-helix	136-143	8
α-helix	145-147	3
β-strand	153-157	5	2
α-helix	166-175	10
α-helix	179-181	3

Chain C: 11 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	4-11	8
β-strand	12	1	3
α-helix	13-15	3
β-strand	17-23	7	4
α-helix	30-37	8
β-strand	51-58	8	4
β-strand	61-68	8	4
α-helix	75-81	7
β-strand	87-93	7	4
α-helix	97-99	3
α-helix	100-110	11
α-helix	114-116	3
β-strand	121-126	6	4
α-helix	134-135	2
α-helix	136-143	8
α-helix	145-147	3
β-strand	153-157	5	4
α-helix	166-175	10

Chain D: 9 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	16-23	8	5
α-helix	30-37	8
β-strand	51-58	8	5
β-strand	61-68	8	5
α-helix	75-81	7
β-strand	87-93	7	5
α-helix	97-99	3
α-helix	100-110	11
α-helix	114-116	3
β-strand	121-126	6	5
α-helix	133-135	3
α-helix	136-143	8
α-helix	145-147	3
β-strand	153-157	5	5
α-helix	166-175	10

Chain E: 10 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	6-9	4
β-strand	16-23	8	6
α-helix	30-37	8
β-strand	51-58	8	6
β-strand	61-68	8	6
α-helix	75-81	7
β-strand	87-93	7	6
α-helix	97-99	3
α-helix	100-112	13
α-helix	114-116	3
β-strand	121-126	6	6
α-helix	133-135	3
α-helix	136-143	8
α-helix	145-147	3
β-strand	153-157	5	6
α-helix	166-175	10

Chain F: 11 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	4-11	8
β-strand	12	1	3
α-helix	13-14	2
β-strand	17-23	7	7
α-helix	30-37	8
β-strand	51-58	8	7
β-strand	61-68	8	7
α-helix	75-81	7
β-strand	87-93	7	7
α-helix	97-99	3
α-helix	100-110	11
α-helix	114-116	3
β-strand	121-126	6	7
α-helix	133-135	3
α-helix	136-143	8
α-helix	145-147	3
β-strand	153-157	5	7
α-helix	166-175	10

Chain G: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	71-74	4
α-helix	87-89	3
β-strand	95-103	9	2
β-strand	109-113	5	2
β-strand	136-141	6	8
α-helix	143-147	5
β-strand	150-158	9	2
β-strand	164-175	12	8
β-strand	178-190	13	8
β-strand	195-203	9	2
α-helix	204-205	2
α-helix	209-217	9
β-strand	222-230	9	8
β-strand	233-244	12	8

Chain H: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	70-72	3
α-helix	87-89	3
β-strand	95-103	9	4
β-strand	109-113	5	4
β-strand	136-141	6	9
α-helix	143-147	5
β-strand	150-158	9	4
β-strand	164-175	12	9
β-strand	179-190	12	9
β-strand	195-203	9	4
α-helix	204-205	2
α-helix	209-217	9
β-strand	222-230	9	9
β-strand	233-244	12	9

4 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ADP-ribosylation factor-like protein 3	A, B, C, D, E, F	protein	183	Mus musculus	Q9WUL7 (AlphaFold model)
Protein unc-119 homolog B	G, H, I, J, K, L	protein	183	Homo sapiens	A6NIH7 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>7OK7_1 ADP-ribosylation factor-like protein 3 (chains A, B, C, D, E, F)
LLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFK
LNVWDIGGQRKIRPYWRSYFENTDILIYVIDSADRKRFEETGQELTELLEEEKLSCVPVL
IFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKK
EHH

Sequence of entity 2 (G, H, I, J, K, L), FASTA

>7OK7_2 Protein unc-119 homolog B (chains G, H, I, J, K, L)
DTIRPEHVLRLSRVTENYLCKPEDNIYSIDFTRFKIRDLETGTVLFEIAKPCVSDQEEDE
EEGGGDVDISAGRFVRYQFTPAFLRLRTVGATVEFTVGDKPVSNFRMIERHYFREHLLKN
FDFDFGFCIPSSRNTCEHIYEFPQLSEDVIRLMIENPYETRSDSFYFVDNKLIMHNKADY
AYN

Ligands and cofactors

ID	Name	Formula	Copies
GNP	Phosphoaminophosphonic acid-guanylate ester	C10 H17 N6 O13 P3	6
MG	Magnesium ion	Mg	6
PO4	Phosphate ion	O4 P	6

Water and common crystallization additives (GOL, EDO) are not listed.

Primary citation

The Structural and Biochemical Characterization of UNC119B Cargo Binding and Release Mechanisms. Yelland, T., Garcia, E., Samarakoon, Y. et al. Biochemistry (2021) 60:1952-1963. DOI 10.1021/acs.biochem.1c00251 · PubMed

Other PDB entries of the same protein (UniProt Q9WUL7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1FZQ 1.7 Å, Crystal structure of murine ARL3-GDP
3BH7 1.9 Å, Crystal structure of the RP2-Arl3 complex bound to GDP-AlF4
4ZI3 2.0 Å, BART-like domain of BARTL1/CCDC104 aa1-133 in complex with Arl3FL bound to GppNHp in P1…
4GOJ 2.1 Å, The Crystal Structure of full length Arl3GppNHp in complex with UNC119a
4ZI2 2.2 Å, BART-like domain of BARTL1/CCDC104 in complex with Arl3FL bound to GppNHp in P21 21 21
3BH6 2.6 Å, Crystal structure of the RP2-Arl3 complex bound to GppNHp

Browse structure collections

About this viewer

MolViewer shows 7OK7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.