7OOP: Pol II-CSB-CSA-DDB1-UVSSA-PAF-SPT6

Name: PDB 7OOP: Pol II-CSB-CSA-DDB1-UVSSA-PAF-SPT6 (Structure 3)
Published: 2021-10-06
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Pol II-CSB-CSA-DDB1-UVSSA-PAF-SPT6 (Structure 3). Determined by electron microscopy at 2.9 Å resolution. Released 6 Oct 2021.

Method: Electron microscopy
Resolution: 2.9 Å
Organisms: Sus scrofa, Homo sapiens
Chains: 26
Atoms: 62,441
Mol. weight: 1548.14 kDa
Ligands: MG, ZN
Released: 6 Oct 2021

Explore 7OOP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7OOP contains 369 α-helices and 456 β-strands across 23 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain a: 3 helices, 32 β-strands

Element	Residues	Length	Sheet
α-helix	2-10	9
α-helix	15-28	14
β-strand	30-32	3	100
β-strand	36-38	3	101
β-strand	46-51	6	102
β-strand	58-63	6	102
β-strand	68-72	5	102
β-strand	82-84	3	101
β-strand	86-90	5	102
β-strand	102-107	6	103
α-helix	108	1
β-strand	114-119	6	103
β-strand	123-128	6	103
β-strand	133-139	7	103
β-strand	144-149	6	104
β-strand	158-163	6	104
β-strand	168-172	5	104
β-strand	177	1	104
β-strand	181-182	2	104
β-strand	189-194	6	105
β-strand	201-206	6	105
β-strand	211-215	5	105
β-strand	224-225	2	105
β-strand	248-253	6	106
β-strand	259-264	6	106
β-strand	268-273	6	106
β-strand	279	1	106
β-strand	296	1	100
β-strand	298-299	2	107
β-strand	307-312	6	107
β-strand	315-320	6	107
β-strand	326-330	5	107
β-strand	337-343	7	100
β-strand	348-353	6	100
β-strand	358-363	6	100

Chain A: 81 helices, 71 β-strands

Element	Residues	Length	Sheet
α-helix	14	1
β-strand	15-16	2	1
β-strand	20-22	3	2
β-strand	25	1	3
α-helix	26-27	2
α-helix	28-34	7
β-strand	43	1	4
β-strand	47-48	2	5
β-strand	51-52	2	5
α-helix	53	1
β-strand	56	1	4
α-helix	60-62	3
β-strand	86-95	10	6
α-helix	100-109	10
β-strand	110	1	7
β-strand	117	1	7
α-helix	124-132	9
α-helix	137-148	12
β-strand	153	1	8
β-strand	187	1	8
β-strand	190-194	5	9
β-strand	197-201	5	9
β-strand	214-216	3	9
α-helix	218-226	9
α-helix	230-235	6
α-helix	246-248	3
β-strand	249-255	7	6
α-helix	256	1
β-strand	264-265	2	10
β-strand	271-272	2	10
α-helix	273-274	2
α-helix	275-295	21
α-helix	300-318	19
α-helix	326-329	4
α-helix	331-333	3
α-helix	334-336	3
α-helix	339-342	4
α-helix	349	1
α-helix	350-354	5
β-strand	357-359	3	11
β-strand	362-369	8	12
β-strand	377-381	5	12
α-helix	382-387	6
β-strand	389-393	5	13
α-helix	394	1
α-helix	399-408	10
β-strand	416-420	5	13
β-strand	426-428	3	13
α-helix	435-438	4
β-strand	445-449	5	13
α-helix	450	1
β-strand	455-459	5	12
α-helix	466-468	3
β-strand	469-477	9	12
β-strand	482-484	3	12
α-helix	489-492	4
β-strand	500-504	5	12
α-helix	509-514	6
α-helix	515-519	5
β-strand	520	1	12
α-helix	521-524	4
β-strand	526-527	2	14
β-strand	532-533	2	14
α-helix	539-548	10
β-strand	554-555	2	15
α-helix	557-564	8
α-helix	573-574	2
β-strand	575	1	16
α-helix	576-577	2
β-strand	579-581	3	17
β-strand	585	1	17
β-strand	586-587	2	15
α-helix	588-595	8
β-strand	602-603	2	18
β-strand	629-631	3	18
β-strand	634-637	4	18
α-helix	642-645	4
α-helix	652-659	8
α-helix	662-683	22
β-strand	686	1	19
α-helix	689-692	4
α-helix	696-721	26
α-helix	727-728	2
α-helix	733-759	27
α-helix	765-772	8
α-helix	778-781	4
α-helix	782-786	5
β-strand	789-790	2	20
β-strand	793	1	21
β-strand	796	1	21
α-helix	798-799	2
β-strand	822-823	2	20
α-helix	833-868	36
β-strand	872-873	2	22
β-strand	879-880	2	22
β-strand	886-888	3	22
α-helix	891-893	3
β-strand	896	1	23
β-strand	902-905	4	24
α-helix	913-920	8
α-helix	927-933	7
β-strand	934	1	25
α-helix	936-944	9
α-helix	946-969	24
β-strand	976-979	4	24
α-helix	983-993	11
α-helix	1001	1
β-strand	1002	1	25
α-helix	1006-1019	14
α-helix	1028-1037	10
α-helix	1039-1048	10
α-helix	1053-1056	4
α-helix	1062-1079	18
β-strand	1080	1	23
α-helix	1081-1082	2
α-helix	1087-1096	10
α-helix	1098-1100	3
α-helix	1121-1128	8
β-strand	1139-1142	4	26
β-strand	1143	1	27
α-helix	1146-1149	4
α-helix	1151-1161	11
β-strand	1164-1165	2	28
α-helix	1166-1169	4
β-strand	1170-1177	8	29
α-helix	1190-1197	8
β-strand	1207-1216	10	29
α-helix	1218-1223	6
α-helix	1228-1238	11
α-helix	1240-1242	3
β-strand	1243-1247	5	29
β-strand	1256-1262	7	29
α-helix	1281-1295	15
β-strand	1297-1299	3	28
β-strand	1307-1310	4	26
β-strand	1319-1322	4	30
β-strand	1328-1331	4	30
β-strand	1335-1338	4	26
α-helix	1343-1347	5
β-strand	1352	1	27
β-strand	1358-1359	2	26
α-helix	1362-1368	7
α-helix	1371-1387	17
α-helix	1395-1404	10
β-strand	1408-1409	2	31
α-helix	1416-1419	4
α-helix	1426-1432	7
α-helix	1435-1445	11
β-strand	1448-1449	2	2
α-helix	1454-1459	6
α-helix	1467-1469	3
β-strand	1471-1475	5	32

Chain b: 30 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	491	1	108
β-strand	499	1	108
α-helix	501-504	4
α-helix	509-524	16
β-strand	528-530	3	109
α-helix	539-551	13
β-strand	569-572	4	109
α-helix	575-588	14
β-strand	594-596	3	109
α-helix	607-616	10
β-strand	620-623	4	109
α-helix	625-630	6
β-strand	642-646	5	109
α-helix	648-651	4
α-helix	657-662	6
β-strand	670-673	4	109
α-helix	682-692	11
α-helix	700-703	4
α-helix	704-708	5
α-helix	709-713	5
α-helix	721-738	18
α-helix	739-741	3
β-strand	742-743	2	109
α-helix	751-753	3
β-strand	759-765	7	110
α-helix	767-769	3
α-helix	770-781	12
α-helix	783-790	8
α-helix	795-807	13
α-helix	809-813	5
α-helix	835-837	3
α-helix	839-854	16
β-strand	858-861	4	110
α-helix	865-877	13
β-strand	882-884	3	110
α-helix	891-893	3
α-helix	894-903	10
β-strand	909-912	4	110
β-strand	928-931	4	110
α-helix	938-948	11
β-strand	957-963	7	110
α-helix	968-987	20
α-helix	998-1002	5
α-helix	1017-1021	5
α-helix	1388-1398	11

Chain B: 56 helices, 82 β-strands

Element	Residues	Length	Sheet
α-helix	16-18	3
α-helix	19-36	18
α-helix	41-49	9
α-helix	50-54	5
α-helix	55-61	7
α-helix	63-64	2
β-strand	67-68	2	33
β-strand	83-84	2	33
β-strand	87-93	7	33
β-strand	97-99	3	34
β-strand	105-107	3	34
α-helix	108-109	2
α-helix	110-116	7
β-strand	121-133	13	33
β-strand	139-153	15	33
α-helix	168-173	6
β-strand	185-187	3	35
β-strand	190-193	4	35
α-helix	194-195	2
β-strand	196-200	5	36
β-strand	206-208	3	37
β-strand	215-223	9	37
β-strand	233-240	8	37
α-helix	254-255	2
β-strand	256-259	4	37
β-strand	267-268	2	37
α-helix	269-275	7
α-helix	281-288	8
α-helix	295-307	13
α-helix	314-324	11
α-helix	332-341	10
α-helix	342-346	5
α-helix	349-351	3
α-helix	358-376	19
α-helix	381-384	4
α-helix	388-390	3
β-strand	391-394	4	36
α-helix	396-423	28
α-helix	431-434	4
α-helix	438-450	13
β-strand	453	1	38
β-strand	463	1	38
β-strand	468-469	2	35
α-helix	470-471	2
α-helix	475-482	8
β-strand	484-486	3	36
α-helix	503-505	3
β-strand	509	1	39
β-strand	523-525	3	36
β-strand	526	1	39
β-strand	531-532	2	40
α-helix	539-547	9
β-strand	551-552	2	41
α-helix	558-561	4
β-strand	565-569	5	41
β-strand	572-577	6	41
α-helix	580-592	13
β-strand	602-605	4	41
β-strand	612-615	4	41
β-strand	621-627	7	40
β-strand	628	1	42
β-strand	633	1	42
α-helix	637-644	8
α-helix	653-658	6
β-strand	662-666	5	40
α-helix	667-670	4
β-strand	675-676	2	40
α-helix	679-682	4
β-strand	695-696	2	40
α-helix	700-703	4
α-helix	708-710	3
α-helix	714-716	3
β-strand	717	1	43
α-helix	719-728	10
β-strand	732	1	44
β-strand	734	1	45
β-strand	747-751	5	45
β-strand	755	1	46
β-strand	759-760	2	47
α-helix	764-767	4
β-strand	776-782	7	48
β-strand	783	1	19
β-strand	793-797	5	48
α-helix	798-802	5
β-strand	808-817	10	45
β-strand	822	1	49
β-strand	825	1	49
β-strand	827-829	3	50
β-strand	848	1	51
β-strand	853	1	52
β-strand	854	1	51
α-helix	855	1
β-strand	859-860	2	45
β-strand	865-867	3	52
β-strand	869-871	3	50
β-strand	890-891	2	50
α-helix	893	1
β-strand	894-895	2	52
α-helix	896-897	2
β-strand	902-911	10	45
β-strand	917-927	11	45
β-strand	934-937	4	48
β-strand	942-949	8	48
β-strand	956-957	2	53
α-helix	961-963	3
β-strand	965-967	3	48
α-helix	969-971	3
β-strand	977	1	43
α-helix	978-993	16
β-strand	997-998	2	47
α-helix	1008-1016	9
β-strand	1025-1026	2	48
β-strand	1028-1029	2	53
α-helix	1035	1
β-strand	1036	1	53
α-helix	1037	1
α-helix	1040	1
β-strand	1041-1050	10	48
β-strand	1051	1	44
α-helix	1055-1057	3
β-strand	1060-1061	2	12
β-strand	1067	1	54
β-strand	1074	1	54
α-helix	1082-1083	2
β-strand	1084-1086	3	11
α-helix	1088-1097	10
α-helix	1100-1104	5
α-helix	1105-1109	5
β-strand	1113-1119	7	1
β-strand	1125	1	1
β-strand	1127-1129	3	55
β-strand	1134-1136	3	55
β-strand	1137	1	56
β-strand	1142	1	56
β-strand	1146-1152	7	1
α-helix	1153-1163	11
β-strand	1167	1	3
β-strand	1170-1172	3	2

Chain c: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	4-13	10
α-helix	22-34	13
α-helix	37-50	14
α-helix	55-67	13
α-helix	68-72	5
α-helix	76-79	4
α-helix	84-93	10
α-helix	96-98	3
α-helix	107-123	17
α-helix	130-140	11

Chain C: 11 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	8-14	7	57
β-strand	18-24	7	57
α-helix	28-40	13
β-strand	44-55	12	58
α-helix	61-69	9
β-strand	73	1	59
α-helix	78-81	4
β-strand	99-106	8	58
α-helix	112	1
β-strand	113-116	4	60
α-helix	117-119	3
β-strand	121-122	2	58
β-strand	129	1	59
α-helix	147-148	2
β-strand	149-153	5	60
β-strand	158-168	11	58
α-helix	174-176	3
β-strand	179-186	8	57
α-helix	200-202	3
α-helix	204-206	3
α-helix	218-220	3
β-strand	229-235	7	57
α-helix	241-269	29

Chain d: 12 helices, 102 β-strands

Element	Residues	Length	Sheet
β-strand	4-10	7	111
β-strand	15-21	7	112
β-strand	30-35	6	112
β-strand	38-44	7	112
β-strand	49-56	8	112
β-strand	61-67	7	113
β-strand	76-81	6	113
β-strand	85-94	10	113
β-strand	97-107	11	113
β-strand	115	1	114
β-strand	121-124	4	115
β-strand	130-134	5	115
β-strand	136	1	114
β-strand	139-144	6	115
β-strand	155-158	4	115
β-strand	164-169	6	116
α-helix	170	1
β-strand	177-184	8	116
β-strand	187-196	10	116
β-strand	201-204	4	116
β-strand	210-211	2	116
β-strand	218-221	4	117
β-strand	229-232	4	117
β-strand	237-240	4	117
β-strand	245-248	4	117
α-helix	251-253	3
β-strand	258-263	6	118
β-strand	270-275	6	118
β-strand	279-288	10	118
β-strand	296-307	12	118
β-strand	313-318	6	119
β-strand	321-325	5	119
β-strand	331-336	6	119
β-strand	347-353	7	119
β-strand	361-365	5	120
α-helix	367-369	3
β-strand	374-379	6	120
β-strand	386-391	6	120
β-strand	398-400	3	121
β-strand	403	1	122
β-strand	410-413	4	123
β-strand	424-428	5	123
β-strand	433-436	4	123
β-strand	445	1	123
β-strand	457-463	7	124
β-strand	467-472	6	124
β-strand	475-478	4	124
β-strand	488-491	4	124
α-helix	496-498	3
β-strand	500	1	125
β-strand	503	1	125
β-strand	507-512	6	125
β-strand	515-522	8	125
β-strand	525-533	9	125
β-strand	538-542	5	126
β-strand	555-560	6	126
β-strand	565-570	6	126
β-strand	575-581	7	126
β-strand	588-595	8	127
β-strand	600-606	7	127
β-strand	610-616	7	127
β-strand	624-630	7	127
β-strand	637-642	6	128
β-strand	647-652	6	128
β-strand	657-662	6	128
β-strand	665-670	6	128
β-strand	678	1	129
β-strand	682	1	130
β-strand	690	1	130
β-strand	693-694	2	129
β-strand	698	1	122
β-strand	699-700	2	129
β-strand	701-702	2	121
β-strand	711-716	6	120
β-strand	720-727	8	131
β-strand	732-741	10	131
β-strand	751	1	131
α-helix	757-759	3
β-strand	762-765	4	131
β-strand	786-795	10	131
β-strand	801-806	6	131
β-strand	811-819	9	132
β-strand	828-835	8	132
β-strand	846-847	2	133
β-strand	848-854	7	132
β-strand	857-862	6	132
β-strand	865-866	2	133
β-strand	872-876	5	134
β-strand	879-884	6	134
β-strand	887-893	7	134
β-strand	899-905	7	134
β-strand	911-917	7	135
β-strand	920-925	6	135
β-strand	930-936	7	135
β-strand	941-948	8	135
β-strand	954-961	8	136
β-strand	964-969	6	136
β-strand	973-978	6	136
α-helix	987-990	4
β-strand	991	1	135
β-strand	993-999	7	136
β-strand	1004-1009	6	111
β-strand	1025-1032	8	111
β-strand	1037-1042	6	111
α-helix	1045-1061	17
α-helix	1070-1073	4
β-strand	1076-1078	3	137
β-strand	1081-1083	3	137
β-strand	1086	1	136
β-strand	1088-1090	3	111
α-helix	1091-1095	5
α-helix	1096-1098	3
α-helix	1102-1108	7
α-helix	1126-1137	12

Chain D: 10 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	16	1	61
β-strand	21	1	61
α-helix	29	1
β-strand	30-31	2	32
α-helix	34-49	16
α-helix	55-58	4
α-helix	59-70	12
α-helix	77-89	13
α-helix	94-103	10
α-helix	108-114	7
α-helix	116-118	3
α-helix	124-137	14
α-helix	138-140	3

15 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-directed RNA polymerase II subunit RPB1	A	protein	1970	Sus scrofa	P11414 (AlphaFold model)
DNA-directed RNA polymerase subunit beta	B	protein	1174	Sus scrofa	I3LGP4 (AlphaFold model)
DNA-directed RNA polymerase II subunit RPB3	C	protein	275	Sus scrofa	I3LCH3 (AlphaFold model)
RPOL4c domain-containing protein	D	protein	142	Sus scrofa	A0A287ADR4 (AlphaFold model)
DNA-directed RNA polymerase II subunit E	E	protein	210	Sus scrofa	I3LSI7
DNA-directed RNA polymerase II subunit F	F	protein	127	Sus scrofa	A0A4X1VEK9
DNA-directed RNA polymerase II subunit RPB7	G	protein	172	Sus scrofa	I3LJZ9
DNA-directed RNA polymerases I, II, and III subunit RPABC3	H	protein	150	Sus scrofa	I3LCB2
DNA-directed RNA polymerase II subunit RPB9	I	protein	125	Sus scrofa	P60899
DNA-directed RNA polymerases I, II, and III subunit RPABC5	J	protein	67	Sus scrofa	A0A4X1VYD0
RNA_pol_L_2 domain-containing protein	K	protein	117	Sus scrofa	F1RKE4
RNA polymerase II subunit K	L	protein	58	Sus scrofa	A0A4X1TRS6

14 more molecules are not listed.

Sequence of entity 1 (A), FASTA

>7OOP_1 DNA-directed RNA polymerase II subunit RPB1 (chains A)
MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDP
RQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVD
SNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKG
HGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEP
RYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAA
HVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVD
FSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYII
RDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWS
TFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQD
TLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHI
NCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEM
GHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKA
HNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKIN
ISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHA
MGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGES
VEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMR
EDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKL
VIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAI
AHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLT
VFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMP
DFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIR
IMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKI
IITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALER
ELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLM
EAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTG
MFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPG
YSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPS
YSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPT
SPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPTSPKY
SPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTS
PKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN

Sequence of entity 2 (B), FASTA

>7OOP_2 DNA-directed RNA polymerase subunit beta (chains B)
MYDADEDMQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVE
DAPPIDLQAEAQHASGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTY
SAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLD
PGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSML
ARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEM
VKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETK
KAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQ
KFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLS
HLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSP
ILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSE
VSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQLKEREYNNYSWQDLVASG
VVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSP
RNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIV
AIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGM
RHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELEGTNRRYTKRDCSTFLRTSE
TGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEG
ITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGY
HLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSR
DGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGC
RNKTQISLVRMPYACKLLFQELMSMSIAPRMMSV

Sequence of entity 3 (C), FASTA

>7OOP_3 DNA-directed RNA polymerase II subunit RPB3 (chains C)
MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLH
DEFIAHRLGLIPLTSDDIVDKLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDL
ISNSPRVIPVTSRNRDNDPSDYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTA
GVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLR
PETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN

Sequence of entity 4 (D), FASTA

>7OOP_4 RPOL4c domain-containing protein (chains D)
MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEV
FMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEG
RFEDEELQQILDDIQTKRSFQY

Sequence of entity 5 (E), FASTA

>7OOP_5 DNA-directed RNA polymerase II subunit E (chains E)
MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTV
LVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVD
MAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVA
RYFGIKRGQVVKIIRPSETAGRYITYRLVQ

Sequence of entity 6 (F), FASTA

>7OOP_6 DNA-directed RNA polymerase II subunit F (chains F)
MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKY
ERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGV
DELIISD

Sequence of entity 7 (G), FASTA

>7OOP_7 DNA-directed RNA polymerase II subunit RPB7 (chains G)
MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQ
PGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFD
PNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS

Sequence of entity 8 (H), FASTA

>7OOP_8 DNA-directed RNA polymerases I, II, and III subunit RPABC3 (chains H)
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVI
ASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGG
LLMRLQGDANNLHGFEVDSRVYLLMKKLAF

Sequence of entity 9 (I), FASTA

>7OOP_9 DNA-directed RNA polymerase II subunit RPB9 (chains I)
MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITH
EVDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCG
HRWTE

Sequence of entity 10 (J), FASTA

>7OOP_10 DNA-directed RNA polymerases I, II, and III subunit RPABC5 (chains J)
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLL
NYAPLEK

Sequence of entity 11 (K), FASTA

>7OOP_11 RNA_pol_L_2 domain-containing protein (chains K)
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAG
YKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE

Sequence of entity 12 (L), FASTA

>7OOP_12 RNA polymerase II subunit K (chains L)
MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1
ZN	Zinc ion	Zn	8

Primary citation

Structural basis of human transcription-DNA repair coupling. Kokic, G., Wagner, F.R., Chernev, A. et al. Nature (2021) 598:368-372. DOI 10.1038/s41586-021-03906-4 · PubMed

Other PDB entries of the same protein (UniProt P11414 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7OO3 2.8 Å, Pol II-CSB-CSA-DDB1-UVSSA (Structure1)
8OEW 2.8 Å, Structure of the mammalian Pol II-Elongin complex, lacking the ELOA latch (composite…
8OEV 2.86 Å, Structure of the mammalian Pol II-SPT6-Elongin complex, lacking ELOA latch (composite…
7OPD 3.0 Å, Pol II-CSB-CRL4CSA-UVSSA-SPT6-PAF (Structure 5)
8OEU 3.04 Å, Structure of the mammalian Pol II-SPT6 complex (composite structure, Structure 4)
8OF0 3.05 Å, Structure of the mammalian Pol II-SPT6-Elongin complex, Structure 1
8P4B 3.2 Å, Structural insights into human co-transcriptional capping - structure 2
7B0Y 3.6 Å, Structure of a transcribing RNA polymerase II-U1 snRNP complex
8P4D 3.6 Å, Structural insights into human co-transcriptional capping - structure 4
8P4C 3.8 Å, Structural insights into human co-transcriptional capping - structure 3
8P4E 3.9 Å, Structural insights into human co-transcriptional capping - structure 5
8P4F 4.0 Å, Structural insights into human co-transcriptional capping - structure 6

Browse structure collections

About this viewer

MolViewer shows 7OOP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.