7OVX: E3 RING ligase binding domain

E3 RING ligase binding domain. Determined by X-ray diffraction at 1.7 Å resolution. Released 22 Jun 2022.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,655
Mol. weight: 21.46 kDa
Released: 22 Jun 2022

Explore 7OVX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7OVX contains 3 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	1
α-helix	7-9	3
β-strand	14-16	3	2
β-strand	22-25	4	2
β-strand	44-46	3	3
β-strand	47	1	1
β-strand	51	1	3
β-strand	55-62	8	2
β-strand	68-74	7	3
α-helix	87-89	3
β-strand	91-97	7	3
β-strand	100-103	4	3
β-strand	110-112	3	3
β-strand	119-125	7	2
β-strand	130-135	6	2
β-strand	140-146	7	2
β-strand	153-159	7	3
β-strand	165-169	5	2

Chain Q: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	15-22	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase TRIM7	A	protein	174	Homo sapiens	Q9C029 (AlphaFold model)
Peptide G	Q	protein	12	Homo sapiens	P46976 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7OVX_1 E3 ubiquitin-protein ligase TRIM7 (chains A)
HHHMVELTLDPDTANPRLILSLDLKSVRLGQRAQDLPNHPRRFDTNTRVLASCGFSSGRH
HWEVEVGSKDGWAFGVARESVRRKGLTPFTPEEGVWAMQLNNGQYWAVTSPERTQLNCGH
LSRVRVALDLEVGAVSFYAVEDMRHLYTFRVNFQERVFPLFSVCSTGTYLRIWP

Sequence of entity 2 (Q), FASTA

>7OVX_2 Peptide G (chains Q)
DNIKRKLDTYLQ

Primary citation

E3 ligase targeting domain. James, L.C. To be published.

Other PDB entries of the same protein (UniProt Q9C029 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7W0Q 1.1 Å, TRIM7 in complex with C-terminal peptide of 2C
7X70 1.25 Å, TRIM7 in complex with C-terminal peptide of NSP8
7X6Y 1.39 Å, TRIM7 in complex with C-terminal peptide of NSP5
7W0S 1.4 Å, TRIM7 in complex with C-terminal peptide of 2C
7X6Z 1.43 Å, TRIM7 in complex with C-terminal peptide of NSP12
9HIN 1.55 Å, Crystal structure of human TRIM7 PRYSPRY domain bound to…
7W0T 1.57 Å, TRIM7 in complex with C-terminal peptide of 2C
6UMA 1.6 Å, Crystal structure of the TRIM7 B30.2 domain at 1.6 angstrom resolution
8R5B 1.6 Å, Crystal structure of human TRIM7 PRYSPRY domain bound to (3-phenoxybenzoyl)-L-glutamine
8R5C 1.6 Å, Crystal structure of human TRIM7 PRYSPRY domain bound to…
8A5L 1.62 Å, TRIM7 PRYSPRY in complex with a 2BC peptide TIEALFQ
7Y3A 1.7 Å, Crystal structure of TRIM7 bound to 2C

Browse structure collections

About this viewer

MolViewer shows 7OVX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.