Solution structure of the N-terminal domain of human telomeric Repeat-binding factor 2-interacting protein 1 (hRap1): implication for Rap1-TRF2 interaction in Human. Determined by solution NMR. Released 5 Oct 2022.
Explore 7OZ0 in 3D Show helices and sheets RCSB PDB PDBe
7OZ0 contains 5 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 22 | 1 | 1 |
| β-strand | 28 | 1 | 1 |
| β-strand | 30-33 | 4 | 2 |
| α-helix | 34 | 1 | |
| α-helix | 39-48 | 10 | |
| β-strand | 52-54 | 3 | 2 |
| α-helix | 61 | 1 | |
| β-strand | 62-65 | 4 | 2 |
| β-strand | 79-80 | 2 | 2 |
| α-helix | 83-89 | 7 | |
| α-helix | 96-99 | 4 | |
| β-strand | 100 | 1 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Telomeric repeat-binding factor 2-interacting protein 1 | A | protein | 114 | Homo sapiens | Q9NYB0 (AlphaFold model) |
>7OZ0_1 Telomeric repeat-binding factor 2-interacting protein 1 (chains A) MAEAMDLGKDPNGPTHSSTLFVRDDGSSMSFYVRPSPAKRRLSTLILHGGGTVCRVQEPG AVLLAQPGEALAEASGDFISTQYILDCVERNERLELEAYRLGPASAADTGSEAK
Solution structure of the N-terminal domain of human telomeric Repeat-binding factor 2-interacting protein 1 (hRap1): implication for Rap1-TRF2 interaction in Human. Miron, S., LeDU, M.H., Gaullier, G. et al. To be published.
Other PDB entries of the same protein (UniProt Q9NYB0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7OZ0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.