7P0S: ORF virus encoded Bcl-2 homolog ORFV125

ORF virus encoded Bcl-2 homolog ORFV125 in complex with Puma BH3 peptide. Determined by X-ray diffraction at 2.5 Å resolution. Released 13 Jul 2022.

Method: X-ray diffraction
Resolution: 2.5 Å
Organisms: Orf virus, Homo sapiens
Chains: 4
Atoms: 2,504
Mol. weight: 38.74 kDa
Released: 13 Jul 2022

Explore 7P0S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7P0S contains 15 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	9-28	20
α-helix	31-58	28
α-helix	60-63	4
α-helix	69-78	10
α-helix	85-101	17
α-helix	107-120	14
α-helix	126-141	16

Chain B: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	9-27	19
α-helix	31-56	26
α-helix	69-78	10
α-helix	85-101	17
α-helix	107-120	14
α-helix	126-141	16

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	134-153	20

Chain U: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	133-150	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Apoptosis inhibitor	A, B	protein	148	Orf virus	A0A0R8HV90
Bcl-2-binding component 3, isoforms 1/2	C, U	protein	26	Homo sapiens	Q9BXH1 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7P0S_1 Apoptosis inhibitor (chains A, B)
GPLGSMANRDDIDASAVMAAYLAREYAEAVEEQLTPRERDALEALRVSGEEVRSPLLQEL
SNAGEHRANPENSHIPAALVSALLEAPTSPGRMVTAVELCAQMGRLWTRGRQLVDFMRLV
YVLLDRLPPTADEDLGAWLQAVARVHGT

Sequence of entity 2 (C, U), FASTA

>7P0S_2 Bcl-2-binding component 3, isoforms 1/2 (chains C, U)
EEQWAREIGAQLRRMADDLNAQYERR

Primary citation

Structural Investigation of Orf Virus Bcl-2 Homolog ORFV125 Interactions with BH3-Motifs from BH3-Only Proteins Puma and Hrk. Suraweera, C.D., Hinds, M.G., Kvansakul, M. Viruses (2021) 13. DOI 10.3390/v13071374 · PubMed

Other PDB entries of the same protein (UniProt A0A0R8HV90), best resolution first:

7P0U 1.99 Å, ORF virus encoded Bcl-2 homolog ORFV125 in complex with Puma BH3 peptide
7ADT 2.21 Å, Orf virus Apoptosis inhibitor ORFV125
7ADS 2.22 Å, Orf virus Apoptosis inhibitor ORFV125

Browse structure collections

About this viewer

MolViewer shows 7P0S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.