7P0U: ORF virus encoded Bcl-2 homolog ORFV125
ORF virus encoded Bcl-2 homolog ORFV125 in complex with Puma BH3 peptide. Determined by X-ray diffraction at 1.99 Å resolution. Released 13 Jul 2022.
- Method
- X-ray diffraction
- Resolution
- 1.99 Å
- Organisms
- Orf virus, Homo sapiens
- Chains
- 8
- Atoms
- 4,869
- Mol. weight
- 77.12 kDa
- Released
- 13 Jul 2022
Explore 7P0U in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
7P0U contains 28 α-helices and 0 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 6 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-27 | 19 | |
| α-helix | 31-57 | 27 | |
| α-helix | 69-79 | 11 | |
| α-helix | 85-101 | 17 | |
| α-helix | 107-120 | 14 | |
| α-helix | 126-140 | 15 | |
Chain B: 6 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-27 | 19 | |
| α-helix | 31-57 | 27 | |
| α-helix | 69-79 | 11 | |
| α-helix | 85-101 | 17 | |
| α-helix | 107-121 | 15 | |
| α-helix | 126-139 | 14 | |
Chain C: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 29-49 | 21 | |
Chain D: 6 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-27 | 19 | |
| α-helix | 31-57 | 27 | |
| α-helix | 69-79 | 11 | |
| α-helix | 85-99 | 15 | |
| α-helix | 108-120 | 13 | |
| α-helix | 126-139 | 14 | |
Chain E: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 29-48 | 20 | |
Chain F: 6 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-28 | 20 | |
| α-helix | 31-57 | 27 | |
| α-helix | 69-78 | 10 | |
| α-helix | 85-101 | 17 | |
| α-helix | 108-120 | 13 | |
| α-helix | 126-141 | 16 | |
Chain G: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 29-47 | 19 | |
Chain U: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 31-49 | 19 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Apoptosis inhibitor | A, B, D, F | protein | 148 | Orf virus | A0A0R8HV90 |
| Activator of apoptosis harakiri | C, E, G, U | protein | 26 | Homo sapiens | O00198 (AlphaFold model) |
Sequence of entity 1 (A, B, D, F), FASTA
>7P0U_1 Apoptosis inhibitor (chains A, B, D, F)
GPLGSMANRDDIDASAVMAAYLAREYAEAVEEQLTPRERDALEALRVSGEEVRSPLLQEL
SNAGEHRANPENSHIPAALVSALLEAPTSPGRMVTAVELCAQMGRLWTRGRQLVDFMRLV
YVLLDRLPPTADEDLGAWLQAVARVHGT
Sequence of entity 2 (C, E, G, U), FASTA
>7P0U_2 Activator of apoptosis harakiri (chains C, E, G, U)
RSSAAQLTAARLKALGDELHQRTMWR
Primary citation
Structural Investigation of Orf Virus Bcl-2 Homolog ORFV125 Interactions with BH3-Motifs from BH3-Only Proteins Puma and Hrk. Suraweera, C.D., Hinds, M.G., Kvansakul, M. Viruses (2021) 13. DOI 10.3390/v13071374 · PubMed
Other PDB entries of the same protein (UniProt A0A0R8HV90), best resolution first:
- 7ADT 2.21 Å, Orf virus Apoptosis inhibitor ORFV125
- 7ADS 2.22 Å, Orf virus Apoptosis inhibitor ORFV125
- 7P0S 2.5 Å, ORF virus encoded Bcl-2 homolog ORFV125 in complex with Puma BH3 peptide
Browse structure collections
About this viewer
MolViewer shows 7P0U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.