7P99: Human USPL1

Structure of human USPL1 in complex with SUMO2. Determined by X-ray diffraction at 1.8 Å resolution. Released 2 Mar 2022.

Method: X-ray diffraction
Resolution: 1.8 Å
Organisms: Homo sapiens, Peromyscus maniculatus bairdii
Chains: 2
Atoms: 3,000
Mol. weight: 50.25 kDa
Ligands: ZN
Released: 2 Mar 2022

Explore 7P99 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7P99 contains 14 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	227	1	1
α-helix	229-231	3
α-helix	236-246	11
α-helix	249-256	8
α-helix	261-263	3
α-helix	265-283	19
α-helix	297-323	27
β-strand	331	1	2
α-helix	333-342	10
α-helix	345-348	4
β-strand	353-360	8	3
β-strand	367-374	8	3
β-strand	377-379	3	4
β-strand	382	1	3
β-strand	387	1	5
β-strand	390	1	5
β-strand	391-395	5	3
β-strand	405-413	9	3
β-strand	417-422	6	4
α-helix	431-434	4
β-strand	436-438	3	4
β-strand	441-452	12	4
β-strand	456-462	7	4
β-strand	468-471	4	4
β-strand	478	1	1
β-strand	480-482	3	4
α-helix	489-491	3
β-strand	492-500	9	4

Chain C: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	18-23	6	6
β-strand	29-34	6	6
α-helix	41-51	11
α-helix	55-57	3
β-strand	58-62	5	6
β-strand	65-66	2	6
α-helix	73-76	4
α-helix	78-79	2
β-strand	82-88	7	6
β-strand	92	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SUMO-specific isopeptidase USPL1	A	protein	338	Homo sapiens	Q5W0Q7 (AlphaFold model)
Small ubiquitin-related modifier	C	protein	101	Peromyscus maniculatus bairdii	P61956 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7P99_1 SUMO-specific isopeptidase USPL1 (chains A)
MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSPLESKCTSFPQALCVQWKNAYALCWL
DCILSALVHSEELKNTVTGLCSKEESIFWRLLTKYNQANTLLYTSQLSGVKDGDCKKLTS
EIFAEIETCLNEVRDEIFISLQPQLRCTLGDMESPVFAFPLLLKLETHIEKLFLYSFSWD
FECSQCGHQYQNRHMKSLVTFTNVIPEWHPLNAAHFGPCNNCNSKSQIRKMVLEKVSPIF
MLHFVEGLPQNDLQHYAFHFEGCLYQITSVIQYRANNHFITWILDADGSWLECDDLKGPC
SERHKKFEVPASEIHIVIWERKISQVTDKEAACLPLKK

Sequence of entity 2 (C), FASTA

>7P99_2 Small ubiquitin-related modifier (chains C)
MGSSHHHHHHSSGLVPRGSHNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYSERQGLS
MRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGAVY

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

Structural basis for the SUMO protease activity of the atypical ubiquitin-specific protease USPL1. Li, Y., Varejao, N., Reverter, D. Nat Commun (2022) 13:1819-1819. DOI 10.1038/s41467-022-29485-0 · PubMed

Other PDB entries of the same protein (UniProt Q5W0Q7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7ZJU 2.17 Å, Structure of human USPL1 in covalent complex with SUMO3-2Br probe
7ZJV 2.4 Å, Structure of human USPL1 in covalent complex with DeltaN-SUMO2/3-PA probe

Browse structure collections

About this viewer

MolViewer shows 7P99 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.