7P9U: Cryo EM structure of System XC-

Cryo EM structure of System XC- in complex with glutamate. Determined by electron microscopy at 3.7 Å resolution. Released 17 Nov 2021.

Method: Electron microscopy
Resolution: 3.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,943
Mol. weight: 125.78 kDa
Ligands: GLU
Released: 17 Nov 2021

Explore 7P9U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7P9U contains 25 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	179-207	29

Chain B: 24 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	47-57	11
α-helix	61-63	3
α-helix	65-73	9
α-helix	76-104	29
α-helix	110-117	8
α-helix	120-129	10
α-helix	130-134	5
α-helix	135-151	17
α-helix	163-182	20
α-helix	185-189	5
α-helix	191-215	25
α-helix	232-234	3
α-helix	235-245	11
α-helix	265-291	27
α-helix	294-298	5
α-helix	303-311	9
α-helix	319-348	30
α-helix	353-356	4
β-strand	358-359	2	1
α-helix	373-381	9
α-helix	385-412	28
α-helix	426-441	16
α-helix	447-459	13
α-helix	462-466	5
α-helix	479-492	14
β-strand	494-495	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
4F2 cell-surface antigen heavy chain	A	protein	638	Homo sapiens	P08195 (AlphaFold model)
Cystine/glutamate transporter	B	protein	509	Homo sapiens	Q9UPY5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7P9U_1 4F2 cell-surface antigen heavy chain (chains A)
MHHHHHHHHELQPPEASIAVVSIPRQLPGSHSEAGVQGLSAGDDSELGSHCVAQTGLELL
ASGDPLPSASQNAEMIETGSDCVTQAGLQLLASSDPPALASKNAEVTGTMSQDTEVDMKE
VELNELEPEKQPMNAASGAAMSLAGAEKNGLVKIKVAEDEAEAAAAAKFTGLSKEELLKV
AGSPGWVRTRWALLLLFWLGWLGMLAGAVVIIVRAPRCRELPAQKWWHTGALYRIGDLQA
FQGHGAGNLAGLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNFGSKEDFDS
LLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVRDIEN
LKDASSFLAEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLLTSSYLSDSGSTG
EHTKSLVTQYLNATGNRWCSWSLSQARLLTSFLPAQLLRLYQLMLFTLPGTPVFSYGDEI
GLDAAALPGQPMEAPVMLWDESSFPDIPGAVSANMTVKGQSEDPGSLLSLFRRLSDQRSK
ERSLLHGDFHAFSAGPGLFSYIRHWDQNERFLVVLNFGDVGLSAGLQASDLPASASLPAK
ADLLLSTQPGREEGSPLELERLKLEPHEGLLLRFPYAA

Sequence of entity 2 (B), FASTA

>7P9U_2 Cystine/glutamate transporter (chains B)
MDYKDDDDKVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSI
IIGTIIGAGIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYT
YILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVG
ITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSI
TRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTI
NAEELLLSNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLP
EILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRY
KCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDK
KPRWFRIMSEKITRTLQIILEVVPEEDKL

Ligands and cofactors

ID	Name	Formula	Copies
GLU	Glutamic acid	C5 H9 N O4	1

Primary citation

Molecular basis for redox control by the human cystine/glutamate antiporter system xc . Parker, J.L., Deme, J.C., Kolokouris, D. et al. Nat Commun (2021) 12:7147-7147. DOI 10.1038/s41467-021-27414-1 · PubMed

Other PDB entries of the same protein (UniProt P08195 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6S8V 1.8 Å, Structure of the high affinity Anticalin P3D11 in complex with the human CD98 heavy…
2DH2 2.1 Å, Crystal Structure of human ED-4F2hc
8G0M 2.25 Å, Structure of complex between TV6.6 and CD98hc ECD
9KJU 2.7 Å, Local refinement of the y+LAT1-4F2hc bound with Arg
2DH3 2.8 Å, Crystal Structure of human ED-4F2hc
7DF1 2.81 Å, Crystal structure of human CD98 heavy chain extracellular domain in complex with S1-F4…
7CMI 2.9 Å, The LAT2-4F2hc complex in complex with leucine
7DSK 2.9 Å, Overall structure of the LAT1-4F2hc bound with JX-075
7DSL 2.9 Å, Overall structure of the LAT1-4F2hc bound with JX-078
8YLP 2.9 Å, Overall structure of the y+LAT1-4F2hc bound with Arg
7DSN 3.1 Å, Overall structure of the LAT1-4F2hc bound with JX-119
8X0W 3.1 Å, Overall structure of the LAT1-4F2hc bound with Leu

Browse structure collections

About this viewer

MolViewer shows 7P9U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.