7P9V: Cryo EM structure of System XC-

Cryo EM structure of System XC-. Determined by electron microscopy at 3.4 Å resolution. Released 17 Nov 2021.

Method: Electron microscopy
Resolution: 3.4 Å
Organism: Homo sapiens
Chains: 2
Atoms: 7,286
Mol. weight: 127.33 kDa
Released: 17 Nov 2021

Explore 7P9V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7P9V contains 49 α-helices and 25 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 23 β-strands

Element	Residues	Length	Sheet
α-helix	169-174	6
α-helix	180-207	28
α-helix	209-211	3
β-strand	225-226	2	1
β-strand	227-228	2	2
α-helix	231-235	5
α-helix	243-246	4
α-helix	249-254	6
β-strand	259-262	4	2
β-strand	266-268	3	3
β-strand	276-281	6	3
α-helix	283-285	3
α-helix	288-300	13
β-strand	304-308	5	2
α-helix	327-331	5
α-helix	332-341	10
β-strand	346-347	2	2
α-helix	357-371	15
β-strand	377-381	5	2
α-helix	386-392	7
β-strand	400-403	4	2
α-helix	404-406	3
α-helix	415-426	12
β-strand	433-434	2	4
α-helix	448-450	3
α-helix	451-460	10
β-strand	464-465	2	4
β-strand	466-467	2	1
α-helix	488-490	3
α-helix	511-514	4
α-helix	520-533	14
α-helix	535-539	5
β-strand	541-545	5	5
β-strand	553-557	5	5
β-strand	565	1	6
β-strand	566	1	5
β-strand	568	1	7
β-strand	576	1	8
α-helix	586-588	3
β-strand	593-599	7	6
β-strand	609-611	3	6
β-strand	616	1	8
β-strand	622	1	7
β-strand	623-626	4	6

Chain B: 28 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	46-57	12
α-helix	61-71	11
α-helix	77-104	28
α-helix	112-115	4
α-helix	120-129	10
α-helix	130-134	5
α-helix	135-151	17
α-helix	162-182	21
α-helix	185-210	26
α-helix	232-234	3
α-helix	235-245	11
α-helix	271-291	21
α-helix	294-299	6
α-helix	303-311	9
α-helix	315-331	17
α-helix	332-334	3
α-helix	337-347	11
α-helix	353-356	4
β-strand	357-359	3	9
α-helix	366-369	4
α-helix	372-381	10
α-helix	385-401	17
α-helix	404-410	7
α-helix	428-438	11
α-helix	440-442	3
α-helix	451-459	9
α-helix	462-465	4
α-helix	474-478	5
α-helix	479-491	13
β-strand	494-496	3	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
4F2 cell-surface antigen heavy chain	A	protein	638	Homo sapiens	P08195 (AlphaFold model)
Cystine/glutamate transporter	B	protein	509	Homo sapiens	Q9UPY5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7P9V_1 4F2 cell-surface antigen heavy chain (chains A)
MHHHHHHHHELQPPEASIAVVSIPRQLPGSHSEAGVQGLSAGDDSELGSHCVAQTGLELL
ASGDPLPSASQNAEMIETGSDCVTQAGLQLLASSDPPALASKNAEVTGTMSQDTEVDMKE
VELNELEPEKQPMNAASGAAMSLAGAEKNGLVKIKVAEDEAEAAAAAKFTGLSKEELLKV
AGSPGWVRTRWALLLLFWLGWLGMLAGAVVIIVRAPRCRELPAQKWWHTGALYRIGDLQA
FQGHGAGNLAGLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNFGSKEDFDS
LLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVRDIEN
LKDASSFLAEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLLTSSYLSDSGSTG
EHTKSLVTQYLNATGNRWCSWSLSQARLLTSFLPAQLLRLYQLMLFTLPGTPVFSYGDEI
GLDAAALPGQPMEAPVMLWDESSFPDIPGAVSANMTVKGQSEDPGSLLSLFRRLSDQRSK
ERSLLHGDFHAFSAGPGLFSYIRHWDQNERFLVVLNFGDVGLSAGLQASDLPASASLPAK
ADLLLSTQPGREEGSPLELERLKLEPHEGLLLRFPYAA

Sequence of entity 2 (B), FASTA

>7P9V_2 Cystine/glutamate transporter (chains B)
MDYKDDDDKVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSI
IIGTIIGAGIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYT
YILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVG
ITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSI
TRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTI
NAEELLLSNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLP
EILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRY
KCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDK
KPRWFRIMSEKITRTLQIILEVVPEEDKL

Primary citation

Molecular basis for redox control by the human cystine/glutamate antiporter system xc . Parker, J.L., Deme, J.C., Kolokouris, D. et al. Nat Commun (2021) 12:7147-7147. DOI 10.1038/s41467-021-27414-1 · PubMed

Other PDB entries of the same protein (UniProt P08195 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6S8V 1.8 Å, Structure of the high affinity Anticalin P3D11 in complex with the human CD98 heavy…
2DH2 2.1 Å, Crystal Structure of human ED-4F2hc
8G0M 2.25 Å, Structure of complex between TV6.6 and CD98hc ECD
9KJU 2.7 Å, Local refinement of the y+LAT1-4F2hc bound with Arg
2DH3 2.8 Å, Crystal Structure of human ED-4F2hc
7DF1 2.81 Å, Crystal structure of human CD98 heavy chain extracellular domain in complex with S1-F4…
7CMI 2.9 Å, The LAT2-4F2hc complex in complex with leucine
7DSK 2.9 Å, Overall structure of the LAT1-4F2hc bound with JX-075
7DSL 2.9 Å, Overall structure of the LAT1-4F2hc bound with JX-078
8YLP 2.9 Å, Overall structure of the y+LAT1-4F2hc bound with Arg
7DSN 3.1 Å, Overall structure of the LAT1-4F2hc bound with JX-119
8X0W 3.1 Å, Overall structure of the LAT1-4F2hc bound with Leu

Browse structure collections

About this viewer

MolViewer shows 7P9V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.