7P9W: Apoptosis regulator BHRF1

Name: PDB 7P9W: Epstein-Barr virus encoded apoptosis regulator BHRF1 in complex with Puma BH3
Published: 2022-08-10
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: apoptosis

Epstein-Barr virus encoded apoptosis regulator BHRF1 in complex with Puma BH3. Determined by X-ray diffraction at 2.0 Å resolution. Released 10 Aug 2022.

Method: X-ray diffraction
Resolution: 2.0 Å
Organisms: Epstein-Barr virus (strain B95-8), Homo sapiens
Chains: 2
Atoms: 1,535
Mol. weight: 24.22 kDa
Ligands: MG, PDO, PO4
Released: 10 Aug 2022

Explore 7P9W in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7P9W contains 12 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	5-18	14
α-helix	24-26	3
α-helix	27-35	9
α-helix	45-60	16
α-helix	62-75	14
α-helix	79-90	12
α-helix	98-117	20
α-helix	123-137	15
α-helix	138-140	3
α-helix	141-146	6
α-helix	150-156	7

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	132-150	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Apoptosis regulator BHRF1	A	protein	173	Epstein-Barr virus (strain B95-8)	P03182 (AlphaFold model)
Bcl-2-binding component 3, isoforms 1/2	B	protein	26	Homo sapiens	Q9BXH1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7P9W_1 Apoptosis regulator BHRF1 (chains A)
MGSHHHHHHSQDPMAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVV
LRYHVLLEEIIERNSETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRALAWMAW
CMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG

Sequence of entity 2 (B), FASTA

>7P9W_2 Bcl-2-binding component 3, isoforms 1/2 (chains B)
EEQWAREIGAQLRRMADDLNAQYERR

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	5
PDO	1,3-propandiol	C3 H8 O2	2
PO4	Phosphate ion	O4 P	3

Water and common crystallization additives (CL, NH4, EDO) are not listed.

Primary citation

Crystal Structures of Epstein-Barr Virus Bcl-2 Homolog BHRF1 Bound to Bid and Puma BH3 Motif Peptides. Suraweera, C.D., Hinds, M.G., Kvansakul, M. Viruses (2022) 14. DOI 10.3390/v14102222 · PubMed

Other PDB entries of the same protein (UniProt P03182 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2XPX 2.05 Å, Crystal structure of BHRF1:Bak BH3 complex
8SM5 2.61 Å, Crystal Structure of BHRF1 from Epstein Barr Virus in complex with BID BH3 peptide
7P33 2.79 Å, Epstein-Barr virus encoded Bcl-2 homolog BHRF-1 in complex with Bid BH3 peptide
1Q59 Solution Structure of the BHRF1 Protein From Epstein-Barr Virus, a Homolog of Human Bcl-2

Browse structure collections

About this viewer

MolViewer shows 7P9W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.