7PPM: SHP2 catalytic domain

SHP2 catalytic domain in complex with IRS1 (889-901) phosphopeptide (pSer-892, pTyr-896). Determined by X-ray diffraction at 1.48 Å resolution. Released 7 Sept 2022.

Method: X-ray diffraction
Resolution: 1.48 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,459
Mol. weight: 34.39 kDa
Released: 7 Sept 2022

Explore 7PPM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7PPM contains 13 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	6-15	10
α-helix	16-19	4
α-helix	25-28	4
α-helix	30-35	6
β-strand	38	1	1
β-strand	48-50	3	2
α-helix	51-52	2
β-strand	63-69	7	2
β-strand	81-85	5	2
α-helix	86-88	3
α-helix	92-101	10
β-strand	106-109	4	2
β-strand	114-115	2	3
β-strand	118-119	2	3
α-helix	126-127	2
β-strand	131-134	4	2
β-strand	137-146	10	2
β-strand	150-159	10	2
β-strand	167-174	8	2
α-helix	187-202	16
α-helix	208	1
β-strand	209-213	5	2
α-helix	218-236	19
α-helix	244-252	9
α-helix	262-280	19

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	894	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein phosphatase non-receptor type 11,Tyrosine-protein phosphatase non-receptor type 11	A	protein	282	Homo sapiens	Q06124 (AlphaFold model)
Insulin receptor substrate 1	B	protein	13	Homo sapiens	P35568 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7PPM_1 Tyrosine-protein phosphatase non-receptor type 11,Tyrosine-protein phosphatase non-receptor type 11 (chains A)
GSGSGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDPNEPV
SDYINANIIMPEFGSSGKKSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEVERGKSK
CVKYWPDEYALKEYGVMRVRNVKESAAHDYTLRELKLSKVGQGNTERTVWQYHFRTWPDH
GVPSDPGGVLDFLEEVHHKQESIMDAGPVVVHSSAGIGRTGTFIVIDILIDIIREKGVDC
DIDVPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRR

Sequence of entity 2 (B), FASTA

>7PPM_2 Insulin receptor substrate 1 (chains B)
EPKSPGEYVNIEF

Primary citation

Structural insights into the pSer/pThr dependent regulation of the SHP2 tyrosine phosphatase in insulin and CD28 signaling. Zeke, A., Takacs, T., Sok, P. et al. Nat Commun (2022) 13:5439-5439. DOI 10.1038/s41467-022-32918-5 · PubMed

Other PDB entries of the same protein (UniProt Q06124 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9EIK 1.25 Å, Crystal structure of N-SH2 domain of SHP2 with T42A mutation bound to GAB1 tyrosine…
3ZM1 1.4 Å, Catalytic domain of human SHP2
4JMG 1.4 Å, Crystal structure of the synthetic protein in complex with pY peptide
3ZM0 1.5 Å, Catalytic domain of human SHP2
3ZM2 1.5 Å, Catalytic domain of human SHP2
3ZM3 1.5 Å, Catalytic domain of human SHP2
7PPL 1.53 Å, SHP2 catalytic domain in complex with IRS1 (625-639) phosphopeptide (pTyr-632, pSer-636)
9EIC 1.58 Å, Crystal structure of unbound N-SH2 domain of SHP2 with T42A mutation
9EHD 1.59 Å, Crystal structure of N-SH2 domain of SHP2 bound to GAB1 tyrosine phosphorylated peptide…
3B7O 1.6 Å, Crystal structure of the human tyrosine phosphatase SHP2 (PTPN11) with an accessible…
4RDD 1.6 Å, Co-crystal structure of SHP2 in complex with a Cefsulodin derivative
5EHR 1.7 Å, Non-receptor Protein Tyrosine Phosphatase SHP2 in Complex with Allosteric Inhibitor SHP099

Browse structure collections

About this viewer

MolViewer shows 7PPM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.