7PWX: DUTPase from M. tuberculosis

dUTPase from M. tuberculosis in complex with Stl. Determined by X-ray diffraction at 2.75 Å resolution. Released 28 Dec 2022.

Method: X-ray diffraction
Resolution: 2.75 Å
Organisms: Mycobacterium tuberculosis H37Rv, Staphylococcus aureus
Chains: 12
Atoms: 12,287
Mol. weight: 189.74 kDa
Released: 28 Dec 2022

Explore 7PWX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7PWX contains 92 α-helices and 80 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain AAA: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	16-25	10
α-helix	76-80	5
α-helix	86-89	4
α-helix	91-105	15
α-helix	109-112	4
α-helix	118-126	9
α-helix	141-151	11

Chain CCC: 11 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	9	1	25
α-helix	13-24	12
α-helix	29-36	8
α-helix	40-48	9
α-helix	52-53	2
β-strand	54	1	25
α-helix	57-65	9
α-helix	69-82	14
α-helix	86-89	4
α-helix	91-107	17
α-helix	109-112	4
α-helix	118-131	14
α-helix	141-151	11

Chain DDD: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	13-24	12
α-helix	29-36	8
α-helix	40-48	9
α-helix	52-54	3
α-helix	55-65	11
α-helix	69-82	14
α-helix	86-89	4
α-helix	91-107	17
α-helix	109-112	4
α-helix	118-130	13
α-helix	141-151	11

Chain EEE: 10 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	9-10	2	26
α-helix	13-24	12
α-helix	29-36	8
α-helix	40-48	9
β-strand	53-54	2	26
α-helix	57-65	9
α-helix	69-82	14
α-helix	86-89	4
α-helix	91-107	17
α-helix	109-112	4
α-helix	118-131	14
α-helix	141-151	11

Chain FFF: 12 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	9	1	27
α-helix	13-24	12
α-helix	29-36	8
α-helix	40-48	9
α-helix	52-53	2
β-strand	54	1	27
α-helix	55-65	11
α-helix	69-82	14
α-helix	86-89	4
α-helix	91-107	17
α-helix	109-112	4
α-helix	118-131	14
α-helix	136-138	3
α-helix	141-152	12

Chain GGG: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	13-25	13
α-helix	29-33	5
α-helix	69-79	11
α-helix	86-89	4
α-helix	91-107	17
α-helix	109-112	4
α-helix	118-131	14
α-helix	141-152	12

Chain HHH: 4 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	4-9	6	1
α-helix	15-17	3
β-strand	27-30	4	2
β-strand	35-37	3	3
β-strand	42-46	5	4
β-strand	49-51	3	1
α-helix	53-54	2
β-strand	57-62	6	2
α-helix	63-64	2
α-helix	65-71	7
β-strand	73-75	3	4
β-strand	80-82	3	2
β-strand	91-96	6	4
β-strand	103-105	3	3
β-strand	110-118	9	2
β-strand	123-126	4	5

Chain III: 5 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	4-8	5	5
β-strand	27-30	4	6
β-strand	35-37	3	7
β-strand	42-46	5	8
β-strand	50-52	3	5
α-helix	53-54	2
β-strand	57-62	6	6
α-helix	63-64	2
α-helix	65-71	7
β-strand	73-75	3	8
β-strand	80-82	3	6
α-helix	89-90	2
β-strand	91-96	6	8
α-helix	101-102	2
β-strand	103-105	3	7
β-strand	110-118	9	6
β-strand	120	1	9
β-strand	123-126	4	10

4 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Deoxyuridine 5'-triphosphate nucleotidohydrolase	HHH, III, JJJ, KKK, LLL, MMM	protein	136	Mycobacterium tuberculosis H37Rv	P9WNS5 (AlphaFold model)
Orf20	AAA, CCC, DDD, EEE, FFF, GGG	protein	147	Staphylococcus aureus	Q9F0J8 (AlphaFold model)

Sequence of entity 1 (HHH, III, JJJ, KKK, LLL, MMM), FASTA

>7PWX_1 Deoxyuridine 5'-triphosphate nucleotidohydrolase (chains HHH, III, JJJ, KKK, LLL, MMM)
MSTTLAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGL
VHPRSGLATRVGLSIVNSPGTIDAGYRGEIKVALINLDPAAPIVVHRGDRIAQLLVQRVE
LVELVEVSSFDEAGLA

Sequence of entity 2 (AAA, CCC, DDD, EEE, FFF, GGG), FASTA

>7PWX_2 Orf20 (chains AAA, CCC, DDD, EEE, FFF, GGG)
AELPTHYGTIIKTLRKYMKLTQSKLSERTGFSQNTISNHENGNRNIGVNEIEIYGKGLGI
PSYILHRISDEFKEKGYSPTLNDFGKFDKMYSYVNKAYYNDGDIYYSSYDLYDETIKLLE
LLKESKINVNDIDYDYVLKLYKQILST

Primary citation

The Bacteriophage-Phage-Inducible Chromosomal Island Arms Race Designs an Interkingdom Inhibitor of dUTPases. Sanz-Frasquet, C., Ciges-Tomas, J.R., Alite, C. et al. Microbiol Spectr (2023) 11:e0323222-e0323222. DOI 10.1128/spectrum.03232-22 · PubMed

Other PDB entries of the same protein (UniProt P9WNS5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3HZA 1.2 Å, Crystal structure of dUTPase H145W mutant
3LOJ 1.25 Å, Structure of Mycobacterium tuberculosis dUTPase H145A mutant
1SIX 1.3 Å, Mycobacterium tuberculosis dUTPase complexed with magnesium and alpha,beta-imido-dUTP
5ECT 1.3 Å, Mycobacterium tuberculosis dUTPase G143STOP mutant
8CGA 1.3 Å, Structure of Mycobacterium tuberculosis dUTPase delta 133A-137S mutant
2PY4 1.49 Å, Full length structure of the Mycobacterium tuberculosis dUTPase complexed with magnesium…
4GCY 1.5 Å, Structure of Mycobacterium tuberculosis dUTPase H21W mutant
1SJN 1.8 Å, Mycobacterium tuberculosis dUTPase complexed with magnesium and alpha,beta-imido-dUTP
3H6D 1.8 Å, Structure of the mycobacterium tuberculosis DUTPase D28N mutant
3I93 1.8 Å, Crystal structure of Mycobacterium tuberculosis dUTPase STOP138T mutant
1SNF 1.85 Å, Mycobacterium tuberculosis dutpase complexed with magnesium and deoxyuridine…
1MQ7 1.95 Å, Crystal structure of dutpase from mycobacterium tuberculosis (RV2697C)

Browse structure collections

About this viewer

MolViewer shows 7PWX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.