7Q12: Human GYS1-GYG1 complex activated state

Human GYS1-GYG1 complex activated state bound to glucose-6-phosphate. Determined by electron microscopy at 3.7 Å resolution. Released 27 Jul 2022.

Method: Electron microscopy
Resolution: 3.7 Å
Organism: Homo sapiens
Chains: 8
Atoms: 20,244
Mol. weight: 494.27 kDa
Ligands: G6P
Released: 27 Jul 2022

Explore 7Q12 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7Q12 contains 116 α-helices and 80 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C and D: 26 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	30-32	3	1
α-helix	43-58	16
β-strand	63-68	6	1
α-helix	70-72	3
β-strand	77-79	3	1
α-helix	83	1
β-strand	84	1	2
β-strand	87	1	2
α-helix	89-96	8
β-strand	101-106	6	1
β-strand	113-118	6	1
α-helix	126-131	6
α-helix	146-168	23
β-strand	175-179	5	1
α-helix	186-193	8
β-strand	198-204	7	1
α-helix	208-213	6
α-helix	221-223	3
α-helix	229-234	6
α-helix	239-251	13
β-strand	254-257	4	1
α-helix	260-270	11
β-strand	276-277	2	1
α-helix	292-311	20
α-helix	320-322	3
β-strand	323-328	6	3
α-helix	339-353	15
β-strand	361-366	6	3
β-strand	372-375	4	4
α-helix	377-410	34
α-helix	424-435	12
α-helix	440-442	3
β-strand	444	1	3
β-strand	446-448	3	4
α-helix	455-463	9
β-strand	473-477	5	3
α-helix	493-499	7
β-strand	502-504	3	3
α-helix	515-522	8
β-strand	526-529	4	3
α-helix	533-539	7
β-strand	550-553	4	3
α-helix	560-576	17
α-helix	579-590	12
α-helix	593-596	4
α-helix	598-616	19

Chains E, F, G and H: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	319-321	3
α-helix	323-325	3
α-helix	339-345	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glycogen [starch] synthase, muscle	A, B, C, D	protein	737	Homo sapiens	P13807 (AlphaFold model)
Glycogenin-1	E, F, G, H	protein	350	Homo sapiens	P46976 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>7Q12_1 Glycogen [starch] synthase, muscle (chains A, B, C, D)
MPLNRTLSMSSLPGLEDWEDEFDLENAVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYFLVGPYTEQGVRTQVELLEAPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPHVVAHFH
EWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALSKAFPEHFTYEPNEADAAQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EDPRNGPLEEDGERYDEDEEAAKDRRNIRAPEWPRRASCTSSTSGSKRNSVDTATSSSLS
TPSEPLSPTSSLGEERN

Sequence of entity 2 (E, F, G, H), FASTA

>7Q12_2 Glycogenin-1 (chains E, F, G, H)
MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIM
VDVLDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREEL
SAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLASEQGSFDGGDQGILNTFFSSWATTDIR
KHLPFIYNLSSISIYSYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPNM
THPEFLILWWNIFTTNVLPLLQQFGLVKDTCSYVNVLSDLVYTLAFSCGFCRKEDVSGAI
SHLSLGEIPAMAQPFVSSEERKERWEQGQADYMGADSFDNIKRKLDTYLQ

Ligands and cofactors

ID	Name	Formula	Copies
G6P	6-O-phosphono-alpha-D-glucopyranose	C6 H13 O9 P	4

Primary citation

Molecular basis for the regulation of human glycogen synthase by phosphorylation and glucose-6-phosphate. McCorvie, T.J., Loria, P.M., Tu, M. et al. Nat Struct Mol Biol (2022) 29:628-638. DOI 10.1038/s41594-022-00799-3 · PubMed

Other PDB entries of the same protein (UniProt P13807 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7ZBN 2.62 Å, Cryo-EM structure of the human GS-GN complex in the inhibited state
8Z0A 2.84 Å, Human GYS1-GYG2 complex (apo)
7Q0B 3.0 Å, Human GYS1-GYG1 complex inhibited state
7Q13 3.0 Å, Human GYS1-GYG1 complex activated state bound to glucose-6-phosphate, uridine…
8CVX 3.5 Å, Human glycogenin-1 and glycogen synthase-1 complex in the presence of glucose-6-phosphate
8CVZ 3.52 Å, Human glycogenin-1 and glycogen synthase-1 complex in the apo ordered state
8CVY 3.6 Å, Human glycogenin-1 and glycogen synthase-1 complex in the apo mobile state
7Q0S 4.0 Å, Human GYS1-GYG1 complex inhibited-like state bound to glucose-6-phosphate

Browse structure collections

About this viewer

MolViewer shows 7Q12 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.