7QCT: PDZ2 of LNX2 with SARS-CoV-2_E PBM complex

PDZ2 of LNX2 with SARS-CoV-2_E PBM complex. Determined by X-ray diffraction at 3.2 Å resolution. Released 20 Apr 2022.

Method: X-ray diffraction
Resolution: 3.2 Å
Organisms: Homo sapiens, Severe acute respiratory syndrome coronavirus 2
Chains: 4
Atoms: 1,483
Mol. weight: 23.08 kDa
Released: 20 Apr 2022

Explore 7QCT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7QCT contains 4 α-helices and 13 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	336-343	8	1
β-strand	353-356	4	1
β-strand	364-369	6	1
α-helix	374-378	5
β-strand	386-390	5	1
β-strand	393-394	2	1
α-helix	400-409	10
β-strand	413-420	8	1

Chain B: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	336-343	8	2
β-strand	353-356	4	2
β-strand	365-369	5	2
α-helix	374-378	5
β-strand	386-390	5	2
β-strand	393-394	2	2
α-helix	400-409	10
β-strand	413-420	8	2

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	119-121	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ligand of Numb protein X 2	A, B	protein	94	Homo sapiens	Q8N448 (AlphaFold model)
Envelope small membrane protein	C, D	protein	12	Severe acute respiratory syndrome coronavirus 2	P0DTC4 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7QCT_1 Ligand of Numb protein X 2 (chains A, B)
GREEIFQVALHKRDSGEQLGIKLVRRTDEPGVFILDLLEGGLAAQDGRLSSNDRVLAING
HDLKYGTPELAAQIIQASGERVNLTIARPGKPQP

Sequence of entity 2 (C, D), FASTA

>7QCT_2 Envelope small membrane protein (chains C, D)
NLNSSRVPDLLV

Primary citation

Interactions of Severe Acute Respiratory Syndrome Coronavirus 2 Protein E With Cell Junctions and Polarity PSD-95/Dlg/ZO-1-Containing Proteins. Zhu, Y., Alvarez, F., Wolff, N. et al. Front Microbiol (2022) 13:829094-829094. DOI 10.3389/fmicb.2022.829094 · PubMed

Other PDB entries of the same protein (UniProt Q8N448 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5E1Y 1.01 Å, PDZ2 of LNX2 at 277K, model with alternate conformations
5E21 1.01 Å, PDZ2 of LNX2 at 277K,single conformer model
2VWR 1.3 Å, Crystal structure of the second pdz domain of numb-binding protein 2
5E22 1.8 Å, The second PDZ domain of Ligand of Numb protein X 2 in the presence of an electric field…
5E11 1.8 Å, Second PDZ domain of Ligand of Numb protein X 2 by Laue crystallography (no electric…
5DIN 1.86 Å, Structural Basis for the Indispensable Role of a Unique Zinc Finger Motif in LNX2…

Browse structure collections

About this viewer

MolViewer shows 7QCT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.