Crystal structure of NHL domain of TRIM2 (full C-terminal). Determined by X-ray diffraction at 1.45 Å resolution. Released 4 May 2022.
Explore 7QRV in 3D Show helices and sheets RCSB PDB PDBe
7QRV contains 12 α-helices and 128 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 472-476 | 5 | 1 |
| β-strand | 478-479 | 2 | 2 |
| β-strand | 485-486 | 2 | 2 |
| β-strand | 489-494 | 6 | 3 |
| β-strand | 499-504 | 6 | 3 |
| β-strand | 509-514 | 6 | 3 |
| β-strand | 519-523 | 5 | 3 |
| β-strand | 526 | 1 | 4 |
| β-strand | 533 | 1 | 4 |
| β-strand | 536-541 | 6 | 5 |
| β-strand | 547-551 | 5 | 5 |
| β-strand | 556-560 | 5 | 5 |
| β-strand | 566-570 | 5 | 5 |
| β-strand | 578-583 | 6 | 6 |
| α-helix | 588 | 1 | |
| β-strand | 589-593 | 5 | 6 |
| β-strand | 598-602 | 5 | 6 |
| β-strand | 608-612 | 5 | 6 |
| β-strand | 615 | 1 | 7 |
| β-strand | 622 | 1 | 7 |
| β-strand | 625-630 | 6 | 8 |
| β-strand | 636-640 | 5 | 8 |
| α-helix | 641-643 | 3 | |
| β-strand | 645-649 | 5 | 8 |
| β-strand | 655-659 | 5 | 8 |
| β-strand | 662 | 1 | 9 |
| β-strand | 669 | 1 | 9 |
| β-strand | 672-677 | 6 | 10 |
| β-strand | 683-687 | 5 | 10 |
| β-strand | 693-696 | 4 | 10 |
| β-strand | 702-706 | 5 | 10 |
| β-strand | 719-721 | 3 | 1 |
| β-strand | 726-731 | 6 | 1 |
| α-helix | 732-734 | 3 | |
| β-strand | 736-741 | 6 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 472-476 | 5 | 21 |
| β-strand | 478-479 | 2 | 22 |
| β-strand | 485-486 | 2 | 22 |
| β-strand | 489-494 | 6 | 23 |
| β-strand | 499-504 | 6 | 23 |
| β-strand | 509-514 | 6 | 23 |
| β-strand | 519-523 | 5 | 23 |
| β-strand | 526 | 1 | 24 |
| β-strand | 533 | 1 | 24 |
| β-strand | 536-541 | 6 | 25 |
| β-strand | 547-551 | 5 | 25 |
| β-strand | 556-560 | 5 | 25 |
| β-strand | 566-570 | 5 | 25 |
| β-strand | 578-583 | 6 | 26 |
| α-helix | 588 | 1 | |
| β-strand | 589-593 | 5 | 26 |
| β-strand | 598-602 | 5 | 26 |
| β-strand | 608-612 | 5 | 26 |
| β-strand | 615 | 1 | 27 |
| β-strand | 622 | 1 | 27 |
| β-strand | 625-630 | 6 | 28 |
| β-strand | 636-640 | 5 | 28 |
| α-helix | 641-643 | 3 | |
| β-strand | 645-649 | 5 | 28 |
| β-strand | 655-659 | 5 | 28 |
| β-strand | 662 | 1 | 29 |
| β-strand | 669 | 1 | 29 |
| β-strand | 672-677 | 6 | 30 |
| β-strand | 683-687 | 5 | 30 |
| β-strand | 693-696 | 4 | 30 |
| β-strand | 702-705 | 4 | 30 |
| β-strand | 719-721 | 3 | 21 |
| β-strand | 726-731 | 6 | 21 |
| α-helix | 732-734 | 3 | |
| β-strand | 736-741 | 6 | 21 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tripartite motif-containing protein 2 | A, B, C, D | protein | 281 | Homo sapiens | Q9C040 (AlphaFold model) |
>7QRV_1 Tripartite motif-containing protein 2 (chains A, B, C, D) SMNPIEDDLIFRVGTKGRNKGEFTNLQGVAASTNGKILIADSNNQCVQIFSNDGQFKSRF GIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSSDGKFKTKIGSGKLMGPKGVSV DRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSNNEIIITDFHN HSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDGSGSFL SYINTSADPLYGPQGLALTSDGHVVVADSGNHCFKVYRYLQ
Comparative structural analyses of the NHL domains from the human E3 ligase TRIM-NHL family. Chaikuad, A., Zhubi, R., Tredup, C. et al. IUCrJ (2022) 9:720-727. DOI 10.1107/S2052252522008582 · PubMed
Other PDB entries of the same protein (UniProt Q9C040 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7QRV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.