7QV1: Bacillus subtilis collided disome
Bacillus subtilis collided disome (Leading 70S). Determined by electron microscopy at 3.5 Å resolution. Released 9 Mar 2022.
- Method
- Electron microscopy
- Resolution
- 3.5 Å
- Organism
- Bacillus subtilis subsp. subtilis str. 168
- Chains
- 53
- Atoms
- 140,774
- Mol. weight
- 2131.51 kDa
- Released
- 9 Mar 2022
Explore 7QV1 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
7QV1 contains 226 α-helices and 291 β-strands across 47 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain 0: 3 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 7-9 | 3 | |
| α-helix | 10-17 | 8 | |
| α-helix | 18-20 | 3 | |
| β-strand | 27-29 | 3 | 1 |
| β-strand | 36-38 | 3 | 1 |
| β-strand | 48-49 | 2 | 2 |
| β-strand | 52-53 | 2 | 2 |
Chain 1: 0 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-9 | 8 | 3 |
| β-strand | 17-22 | 6 | 3 |
| β-strand | 31-36 | 6 | 3 |
| β-strand | 41-47 | 7 | 3 |
Chain 2: 3 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-16 | 8 | |
| α-helix | 18-23 | 6 | |
| α-helix | 25-37 | 13 | |
Chain 3: 7 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-6 | 4 | |
| α-helix | 8-11 | 4 | |
| β-strand | 15-16 | 2 | 6 |
| α-helix | 18-20 | 3 | |
| β-strand | 22-25 | 4 | 6 |
| α-helix | 33-35 | 3 | |
| α-helix | 38-44 | 7 | |
| β-strand | 47-49 | 3 | 6 |
| α-helix | 52-58 | 7 | |
| α-helix | 59-61 | 3 | |
Chain 4: 2 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-3 | 2 | 8 |
| β-strand | 15-17 | 3 | 8 |
| α-helix | 19-21 | 3 | |
| β-strand | 24-26 | 3 | 8 |
| α-helix | 30-32 | 3 | |
| β-strand | 34-35 | 2 | 8 |
Chain 6: 4 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 7-9 | 3 | |
| β-strand | 10-15 | 6 | 9 |
| β-strand | 21-26 | 6 | 9 |
| β-strand | 30-32 | 3 | 9 |
| α-helix | 41-44 | 4 | |
| α-helix | 48-53 | 6 | |
| α-helix | 55-57 | 3 | |
Chain b: 4 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 12-22 | 11 | |
| α-helix | 23-25 | 3 | |
| α-helix | 31-34 | 4 | |
| α-helix | 41-54 | 14 | |
Chain c: 5 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 12 | 1 | 10 |
| β-strand | 16 | 1 | 10 |
| β-strand | 20 | 1 | 11 |
| α-helix | 28-46 | 19 | |
| β-strand | 53-58 | 6 | 11 |
| β-strand | 62-68 | 7 | 11 |
| α-helix | 72-74 | 3 | |
| α-helix | 80-94 | 15 | |
| β-strand | 97-103 | 7 | 11 |
| α-helix | 112-124 | 13 | |
| α-helix | 131-143 | 13 | |
| β-strand | 147-154 | 8 | 12 |
| β-strand | 165-170 | 6 | 12 |
| β-strand | 182-190 | 9 | 12 |
| β-strand | 193-202 | 10 | 12 |
39 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| 50S ribosomal protein L32 | 0 | protein | 59 | Bacillus subtilis subsp. subtilis str. 168 | O34687 (AlphaFold model) |
| 50S ribosomal protein L33 1 | 1 | protein | 49 | Bacillus subtilis subsp. subtilis str. 168 | P56849 (AlphaFold model) |
| 50S ribosomal protein L34 | 2 | protein | 44 | Bacillus subtilis subsp. subtilis str. 168 | P05647 (AlphaFold model) |
| 50S ribosomal protein L35 | 3 | protein | 66 | Bacillus subtilis subsp. subtilis str. 168 | P55874 (AlphaFold model) |
| 50S ribosomal protein L36 | 4 | protein | 37 | Bacillus subtilis subsp. subtilis str. 168 | P20278 |
| 50S ribosomal protein L31 | 6 | protein | 66 | Bacillus subtilis subsp. subtilis str. 168 | Q03223 |
| 5S ribosomal RNA | B | RNA | 112 | Bacillus subtilis subsp. subtilis str. 168 | |
| 50S ribosomal protein L2 | C | protein | 277 | Bacillus subtilis subsp. subtilis str. 168 | P42919 |
| 50S ribosomal protein L3 | D | protein | 209 | Bacillus subtilis subsp. subtilis str. 168 | P42920 |
| 50S ribosomal protein L4 | E | protein | 207 | Bacillus subtilis subsp. subtilis str. 168 | P42921 |
| 50S ribosomal protein L5 | F | protein | 179 | Bacillus subtilis subsp. subtilis str. 168 | P12877 |
| 50S ribosomal protein L6 | G | protein | 179 | Bacillus subtilis subsp. subtilis str. 168 | P46898 |
41 more molecules are not listed.
Sequence of entity 1 (0), FASTA
>7QV1_1 50S ribosomal protein L32 (chains 0)
MAVPFRRTSKMKKRLRRTHFKLNVPGMTECPSCGEMKLSHRVCKACGSYNGKDINVKSN
Sequence of entity 2 (1), FASTA
>7QV1_2 50S ribosomal protein L33 1 (chains 1)
MRVNITLACTECGERNYISKKNKRNNPDRVEFKKYCPRDKKSTLHRETK
Sequence of entity 3 (2), FASTA
>7QV1_3 50S ribosomal protein L34 (chains 2)
MKRTFQPNNRKRSKVHGFRSRMSSKNGRLVLARRRRKGRKVLSA
Sequence of entity 4 (3), FASTA
>7QV1_4 50S ribosomal protein L35 (chains 3)
MPKMKTHRGSAKRFKKTGSGKLKRSHAYTSHLFANKSQKQKRKLRKSAVVSAGDFKRIKQ
MLANIK
Sequence of entity 5 (4), FASTA
>7QV1_5 50S ribosomal protein L36 (chains 4)
MKVRPSVKPICEKCKVIRRKGKVMVICENPKHKQKQG
Sequence of entity 6 (6), FASTA
>7QV1_6 50S ribosomal protein L31 (chains 6)
MKAGIHPNFKKATVKCACGNEFETGSVKEEVRVEICSECHPFYTGRQKFASADGRVDRFN
KKYGLK
Sequence of entity 7 (B), FASTA
>7QV1_7 5S ribosomal RNA (chains B)
UGGUGGCGAUAGCGAAGAGGUCACACCCGUUCCCAUACCGAACACGGAAGUUAAGCUCUU
CAGCGCCGAUGGUAGUCGGGGGUUUCCCCCUGUGAGAGUAGGACGCCGCCAA
Sequence of entity 8 (C), FASTA
>7QV1_8 50S ribosomal protein L2 (chains C)
MAIKKYKPTSNGRRGMTTSDFAEITTDKPEKSLLAPLHKKGGRNNQGKLTVRHQGGGHKR
QYRVIDFKRDKDGIPGRVATVEYDPNRSANIALINYADGEKRYILAPKGIQVGTEIMSGP
EADIKVGNALPLINIPVGTVVHNIELKPGKGGQLVRSAGTSAQVLGKEGKYVLVRLNSGE
VRMILSACRASIGQVGNEQHELINIGKAGRSRWKGIRPTVRGSVMNPNDHPHGGGEGRAP
IGRKSPMSPWGKPTLGFKTRKKKNKSDKFIVRRRKNK
Sequence of entity 9 (D), FASTA
>7QV1_9 50S ribosomal protein L3 (chains D)
MTKGILGRKIGMTQVFAENGDLIPVTVIEAAPNVVLQKKTAENDGYEAIQLGFDDKREKL
SNKPEKGHVAKAETAPKRFVKELRGVEMDAYEVGQEVKVEIFSAGEIVDVTGVSKGKGFQ
GAIKRHGQSRGPMSHGSRYHRRPGSMGPVDPNRVFKGKLLPGRMGGEQITVQNLEIVKVD
AERNLLLIKGNVPGAKKSLITVKSAVKSK
Sequence of entity 10 (E), FASTA
>7QV1_10 50S ribosomal protein L4 (chains E)
MPKVALYNQNGSTAGDIELNASVFGIEPNESVVFDAILMQRASLRQGTHKVKNRSEVRGG
GRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYSYKLPKKVRRLAIKSVLSSKVID
NNIIVLEDLTLDTAKTKEMAAILKGLSVEKKALIVTADANEAVALSARNIPGVTVVEANG
INVLDVVNHEKLLITKAAVEKVEEVLA
Sequence of entity 11 (F), FASTA
>7QV1_11 50S ribosomal protein L5 (chains F)
MNRLKEKYNKEIAPALMTKFNYDSVMQVPKIEKIVINMGVGDAVQNAKAIDSAVEELTFI
AGQKPVVTRAKKSIAGFRLREGMPIGAKVTLRGERMYDFLDKLISVSLPRVRDFRGVSKK
SFDGRGNYTLGIKEQLIFPEIDYDKVTKVRGMDIVIVTTANTDEEARELLTQVGMPFQK
Sequence of entity 12 (G), FASTA
>7QV1_12 50S ribosomal protein L6 (chains G)
MSRVGKKLLEIPSDVTVTLNDNNTVAVKGPKGELTRTFHPDMEIKVEDNVLTVARPSDQK
EHRALHGTTRSLLGNMVEGVSKGFERGLELVGVGYRASKSGNKLVLNVGYSHPVEIVPEE
GIEIEVPSQTKVVVKGTDKERVGAIAANIRAVRSPEPYKGKGIRYEGEVVRRKEGKSAK
Primary citation
Bacterial ribosome collision sensing by a MutS DNA repair ATPase paralogue. Cerullo, F., Filbeck, S., Patil, P.R. et al. Nature (2022) 603:509-514. DOI 10.1038/s41586-022-04487-6 · PubMed
Other PDB entries of the same protein (UniProt O34687 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 8S1P 1.96 Å, YlmH bound to PtRNA-50S
- 8QCQ 2.3 Å, B. subtilis ApdA-stalled ribosomal complex
- 9FY1 2.3 Å, Structure of CliM-stalled Bacillus subtilis 70S ribosome with release factor bound in…
- 9FY2 2.3 Å, Structure of CliM-stalled Bacillus subtilis 70S ribosome with empty A-site
- 9FY3 2.8 Å, Structure of CliM-stalled Bacillus subtilis 70S ribosome with tRNA-Tyr in the A-site
- 7AS8 2.9 Å, Bacillus subtilis ribosome quality control complex state B. Ribosomal 50S subunit with…
- 8BUU 2.9 Å, ARE-ABCF VmlR2 bound to a 70S ribosome
- 7AQC 2.99 Å, Structure of the bacterial RQC complex (Decoding State)
- 7SAE 3.0 Å, 44SR70P Class1 ribosomal particle
- 6TNN 3.07 Å, Mini-RNase III (Mini-III) bound to 50S ribosome with precursor 23S rRNA
- 6TPQ 3.07 Å, RNase M5 bound to 50S ribosome with precursor 5S rRNA
- 6HA1 3.1 Å, Cryo-EM structure of a 70S Bacillus subtilis ribosome translating the ErmD leader…
Browse structure collections
About this viewer
MolViewer shows 7QV1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.