ATAD2 in complex with FragLite23. Determined by X-ray diffraction at 1.44 Å resolution. Released 23 Nov 2022.
Explore 7QYL in 3D Show helices and sheets RCSB PDB PDBe
7QYL contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 980-1001 | 22 | |
| α-helix | 1004-1009 | 6 | |
| α-helix | 1012-1014 | 3 | |
| α-helix | 1021-1024 | 4 | |
| α-helix | 1031-1039 | 9 | |
| α-helix | 1046-1063 | 18 | |
| α-helix | 1069-1092 | 24 | |
| α-helix | 1095-1106 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| ATPase family AAA domain-containing protein 2 | AAA | protein | 130 | Homo sapiens | Q6PL18 (AlphaFold model) |
>7QYL_1 ATPase family AAA domain-containing protein 2 (chains AAA) SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKI DLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFE QLCEEIQESR
| ID | Name | Formula | Copies |
|---|---|---|---|
| UU1 | 2-(4-bromo-1H-pyrazol-1-yl)ethan-1-ol | C5 H7 Br N2 O | 2 |
Water and common crystallization additives (SO4, CL, EDO) are not listed.
Mapping Ligand Interactions of Bromodomains BRD4 and ATAD2 with FragLites and PepLites─Halogenated Probes of Druglike and Peptide-like Molecular Interactions. Davison, G., Martin, M.P., Turberville, S. et al. J Med Chem (2022) 65:15416-15432. DOI 10.1021/acs.jmedchem.2c01357 · PubMed
Other PDB entries of the same protein (UniProt Q6PL18 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7QYL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.