7RCH: NS1-ED of Vietnam influenza A virus

Crystal structure of NS1-ED of Vietnam influenza A virus in complex with the p85-beta-iSH2 domain of human PI3K. Determined by X-ray diffraction at 3.1 Å resolution. Released 13 Jul 2022.

Method: X-ray diffraction
Resolution: 3.1 Å
Organisms: Influenza A virus (A/Viet Nam/1203/2004(H5N1)), Homo sapiens
Chains: 4
Atoms: 4,204
Mol. weight: 68.03 kDa
Released: 13 Jul 2022

Explore 7RCH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7RCH contains 15 α-helices and 14 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	83-86	4	1
α-helix	90-94	5
β-strand	102-107	6	1
β-strand	110-115	6	1
β-strand	122-132	11	1
β-strand	135-145	11	1
β-strand	151-157	7	1
α-helix	166-181	16
β-strand	186-189	4	1
α-helix	191-195	5

Chain B: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	82-86	5	2
α-helix	90-94	5
β-strand	102-107	6	2
β-strand	110-115	6	2
β-strand	122-132	11	2
β-strand	135-146	12	2
β-strand	151-157	7	2
α-helix	158	1
α-helix	166-182	17
β-strand	186-189	4	2
α-helix	191-196	6

Chain C: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	435-490	56
α-helix	534-561	28
α-helix	564-583	20
α-helix	588-594	7

Chain D: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	435-495	61
α-helix	528-561	34
α-helix	564-583	20
α-helix	588-595	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Non-structural protein 1	A, B	protein	126	Influenza A virus (A/Viet Nam/1203/2004(H5N1))	A5A5U1
Phosphatidylinositol 3-kinase regulatory subunit beta	C, D	protein	165	Homo sapiens	O00459 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7RCH_1 Non-structural protein 1 (chains A, B)
ASRYLTDMTLEEMSRDWFMLMPKQKVAGSLCIKMDQAIMDKTIILKANFSVIFDRLETLI
LLRAFTEEGAIVGEISPLPSLPGHTGEDVKNAIGVLIGGLEANDNTVRVTETIQRFAWRN
SDEDGR

Sequence of entity 2 (C, D), FASTA

>7RCH_2 Phosphatidylinositol 3-kinase regulatory subunit beta (chains C, D)
GSKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAIEAFNETIKIFE
EQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRTKLEQQLRAQASD
NREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGI

Primary citation

Energy landscape reshaped by strain-specific mutations underlies epistasis in NS1 evolution of influenza A virus. Kim, I., Dubrow, A., Zuniga, B. et al. Nat Commun (2022) 13:5775-5775. DOI 10.1038/s41467-022-33554-9 · PubMed

Other PDB entries of the same protein (UniProt A5A5U1), best resolution first:

3F5T 2.7 Å, X-ray Structure of H5N1 NS1

Browse structure collections

About this viewer

MolViewer shows 7RCH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.