7RUP: Human GIGYF2-TNRC6A complex

Structure of the human GIGYF2-TNRC6A complex. Determined by X-ray diffraction at 1.23 Å resolution. Released 24 Aug 2022.

Method: X-ray diffraction
Resolution: 1.23 Å
Organism: Homo sapiens
Chains: 2
Atoms: 697
Mol. weight: 10.03 kDa
Released: 24 Aug 2022

Explore 7RUP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7RUP contains 4 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	536-539	4	1
α-helix	544	1
β-strand	545-549	5	1
α-helix	551-560	10
β-strand	568-571	4	1
β-strand	578-579	2	1
α-helix	580-587	8

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	1479-1481	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
GRB10-interacting GYF protein 2	A	protein	73	Homo sapiens	Q6Y7W6 (AlphaFold model)
Trinucleotide repeat-containing gene 6A protein	B	protein	16	Homo sapiens	Q8NDV7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7RUP_1 GRB10-interacting GYF protein 2 (chains A)
GPLEMHEAMQKWYYKDPQGEIQGPFNNQEMAEWFQAGYFTMSLLVKRACDESFQPLGDIM
KMWGRVPFSPGPA

Sequence of entity 2 (B), FASTA

>7RUP_2 Trinucleotide repeat-containing gene 6A protein (chains B)
GPLGSAPSRPPPGLTG

Primary citation

Molecular basis for GIGYF-TNRC6 complex assembly. Sobti, M., Mead, B.J., Stewart, A.G. et al. RNA (2023) 29:724-734. DOI 10.1261/rna.079596.123 · PubMed

Other PDB entries of the same protein (UniProt Q6Y7W6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5NVM 2.0 Å, Crystal structure of the human 4EHP-GIGYF2 complex lacking the auxiliary sequences
5NVL 2.3 Å, Crystal structure of the human 4EHP-GIGYF2 complex

Browse structure collections

About this viewer

MolViewer shows 7RUP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.