Structure of the human GIGYF2-TNRC6A complex. Determined by X-ray diffraction at 1.23 Å resolution. Released 24 Aug 2022.
Explore 7RUP in 3D Show helices and sheets RCSB PDB PDBe
7RUP contains 4 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 536-539 | 4 | 1 |
| α-helix | 544 | 1 | |
| β-strand | 545-549 | 5 | 1 |
| α-helix | 551-560 | 10 | |
| β-strand | 568-571 | 4 | 1 |
| β-strand | 578-579 | 2 | 1 |
| α-helix | 580-587 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1479-1481 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| GRB10-interacting GYF protein 2 | A | protein | 73 | Homo sapiens | Q6Y7W6 (AlphaFold model) |
| Trinucleotide repeat-containing gene 6A protein | B | protein | 16 | Homo sapiens | Q8NDV7 (AlphaFold model) |
>7RUP_1 GRB10-interacting GYF protein 2 (chains A) GPLEMHEAMQKWYYKDPQGEIQGPFNNQEMAEWFQAGYFTMSLLVKRACDESFQPLGDIM KMWGRVPFSPGPA
>7RUP_2 Trinucleotide repeat-containing gene 6A protein (chains B) GPLGSAPSRPPPGLTG
Molecular basis for GIGYF-TNRC6 complex assembly. Sobti, M., Mead, B.J., Stewart, A.G. et al. RNA (2023) 29:724-734. DOI 10.1261/rna.079596.123 · PubMed
Other PDB entries of the same protein (UniProt Q6Y7W6 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7RUP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.