7RYQ: Cryo-EM map of KIFBP

Cryo-EM map of KIFBP. Determined by electron microscopy at 4.6 Å resolution. Released 8 Sept 2021.

Method: Electron microscopy
Resolution: 4.6 Å
Organism: Homo sapiens
Chains: 1
Atoms: 4,332
Mol. weight: 71.91 kDa
Released: 8 Sept 2021

Explore 7RYQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7RYQ contains 24 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 24 helices, 0 β-strands

Element	Residues	Length
α-helix	6-20	15
α-helix	39-50	12
α-helix	87-104	18
α-helix	113-127	15
α-helix	137-151	15
α-helix	155-172	18
α-helix	201-205	5
α-helix	207-221	15
α-helix	224-238	15
α-helix	246-263	18
α-helix	266-279	14
α-helix	302-305	4
α-helix	307-324	18
α-helix	325-327	3
α-helix	347-363	17
α-helix	369-380	12
α-helix	390-409	20
α-helix	416-433	18
α-helix	441-459	19
α-helix	465-491	27
α-helix	501-524	24
α-helix	540-554	15
α-helix	561-583	23
α-helix	592-620	29

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
KIF-binding protein	B	protein	621	Homo sapiens	Q96EK5 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>7RYQ_1 KIF-binding protein (chains B)
MANVPWAEVCEKFQAALALSRVELHKNPEKEPYKSKYSARALLEEVKALLGPAPEDEDER
PEAEDGPGAGDHALGLPAEVVEPEGPVAQRAVRLAVIEFHLGVNHIDTEELSAGEEHLVK
CLRLLRRYRLSHDCISLCIQAQNNLGILWSEREEIETAQAYLESSEALYNQYMKEVGSPP
LDPTERFLPEEEKLTEQERSKRFEKVYTHNLYYLAQVYQHLEMFEKAAHYCHSTLKRQLE
HNAYHPIEWAINAATLSQFYINKLCFMEARHCLSAANVIFGQTGKISATEDTPEAEGEVP
ELYHQRKGEIARCWIKYCLTLMQNAQLSMQDNIGELDLDKQSELRALRKKELDEEESIRK
KAVQFGTGELCDAISAVEEKVSYLRPLDFEEARELFLLGQHYVFEAKEFFQIDGYVTDHI
EVVQDHSALFKVLAFFETDMERRCKMHKRRIAMLEPLTVDLNPQYYLLVNRQIQFEIAHA
YYDMMDLKVAIADRLRDPDSHIVKKINNLNKSALKYYQLFLDSLRDPNKVFPEHIGEDVL
RPAMLAKFRVARLYGKIITADPKKELENLATSLEHYKFIVDYCEKHPEAAQEIEVELELS
KEMVSLLPTKMERFRTKMALT

Primary citation

Kinesin-binding protein remodels the kinesin motor to prevent microtubule binding. Solon, A.L., Tan, Z., Schutt, K.L. et al. Sci Adv (2021) 7:eabj9812-eabj9812. DOI 10.1126/sciadv.abj9812 · PubMed

Other PDB entries of the same protein (UniProt Q96EK5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7RSQ 3.8 Å, Cryo-EM structure of KIFBP core
6ZPG 4.6 Å, Kinesin binding protein (KBP)
7RYP 4.8 Å, Cryo-EM structure of KIFBP:KIF15
7RSI 4.9 Å, The cryo-EM map of KIF18A bound to KIFBP
6ZPH 6.9 Å, Kinesin binding protein complexed with Kif15 motor domain

Browse structure collections

About this viewer

MolViewer shows 7RYQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.