7S58: Evasin P974

Crystal Structure of the tick evasin EVA-P974 complexed to human chemokine CCL7. Determined by X-ray diffraction at 1.82 Å resolution. Released 16 Mar 2022.

Method: X-ray diffraction
Resolution: 1.82 Å
Organisms: Amblyomma cajennense, Homo sapiens
Chains: 8
Atoms: 4,716
Mol. weight: 74.71 kDa
Released: 16 Mar 2022

Explore 7S58 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7S58 contains 30 α-helices and 64 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	11-12	2	1
β-strand	13-16	4	2
β-strand	21-24	4	2
β-strand	27-29	3	3
β-strand	34-36	3	3
α-helix	37-38	2
β-strand	41	1	4
β-strand	42-44	3	2
α-helix	48-53	6
α-helix	55	1
β-strand	60-68	9	2
β-strand	71-82	12	2

Chains B and C: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	11-12	2	5
β-strand	13-16	4	6
β-strand	21-24	4	6
β-strand	27-30	4	7
β-strand	33-36	4	7
α-helix	37-38	2
β-strand	41	1	8
β-strand	42-44	3	6
α-helix	48-53	6
α-helix	55	1
β-strand	60-68	9	6
β-strand	71-82	12	6

Chain D: 4 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3
β-strand	11-12	2	13
β-strand	13-15	3	14
β-strand	21-24	4	14
β-strand	27-30	4	15
β-strand	33-36	4	15
α-helix	37-38	2
β-strand	41	1	16
β-strand	42-44	3	14
α-helix	48-53	6
α-helix	55	1
β-strand	56	1	17
β-strand	60-68	9	14
β-strand	71-82	12	14
β-strand	83	1	17

Chain E: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	10-11	2	5
α-helix	19-21	3
α-helix	22-24	3
β-strand	25-30	6	18
α-helix	32-34	3
β-strand	38	1	19
β-strand	41-45	5	18
β-strand	50-53	4	18
β-strand	57	1	12
α-helix	58-70	13
α-helix	72-74	3
β-strand	75	1	2

Chain F: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	10-11	2	13
α-helix	19-21	3
α-helix	22-24	3
β-strand	25-29	5	20
β-strand	38	1	21
β-strand	41-45	5	20
β-strand	50-53	4	20
β-strand	57	1	4
α-helix	58-68	11
α-helix	72-74	3

Chain H: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	10-11	2	1
α-helix	19-21	3
α-helix	22-24	3
β-strand	25-29	5	23
β-strand	38	1	21
β-strand	41-45	5	23
β-strand	50-53	4	23
β-strand	57	1	16
α-helix	58-70	13
α-helix	72-74	3

Chain J: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	10-11	2	9
α-helix	19-21	3
α-helix	22-24	3
β-strand	25-30	6	22
α-helix	32-34	3
β-strand	38	1	19
β-strand	41-45	5	22
β-strand	50-53	4	22
β-strand	57	1	8
α-helix	58-70	13
β-strand	75	1	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Evasin P974	A, B, C, D	protein	85	Amblyomma cajennense	A0A023FDY8 (AlphaFold model)
C-C motif chemokine 7	E, F, H, J	protein	76	Homo sapiens	P80098 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>7S58_1 Evasin P974 (chains A, B, C, D)
DYDYGTDTCPFPVLANKTNKAKFVGCHQKCNGGDQKLTDGTACYVVERKVWDRMTPMLWY
ECPLGECKNGVCEDLRKKEDCRKGN

Sequence of entity 2 (E, F, H, J), FASTA

>7S58_2 C-C motif chemokine 7 (chains E, F, H, J)
QPVGINTSTTCCYRFINKKIPKQRLESYRRTTSSHCPREAVIFKTKLDKEICADPTQKWV
QDFMKHLDKKTQTPKL

Primary citation

Structure-guided engineering of tick evasins for targeting chemokines in inflammatory diseases. Bhusal, R.P., Aryal, P., Devkota, S.R. et al. Proc Natl Acad Sci U S A (2022) 119. DOI 10.1073/pnas.2122105119 · PubMed

Other PDB entries of the same protein (UniProt A0A023FDY8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7S4N 1.65 Å, Crystal structure of the tick evasin EVA-P974 complexed to human chemokine CCL17
7SO0 1.74 Å, Crystal Structure of the Engineered Tick Evasin EVA-P974(F31A) Complexed to Human…
7S59 2.39 Å, Crystal structure of the tick evasin EVA-P974 complexed to a chimera made of human…

Browse structure collections

About this viewer

MolViewer shows 7S58 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.