Crystal structure of the tick evasin EVA-P974 complexed to a chimera made of human chemokines CCL7 and CCL8. Determined by X-ray diffraction at 2.39 Å resolution. Released 16 Mar 2022.
Explore 7S59 in 3D Show helices and sheets RCSB PDB PDBe
7S59 contains 12 α-helices and 24 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 11-12 | 2 | 1 |
| β-strand | 13-15 | 3 | 2 |
| β-strand | 21-24 | 4 | 2 |
| β-strand | 27-30 | 4 | 3 |
| β-strand | 33-36 | 4 | 3 |
| α-helix | 37-38 | 2 | |
| β-strand | 42-44 | 3 | 2 |
| α-helix | 48-53 | 6 | |
| α-helix | 54-55 | 2 | |
| β-strand | 60-68 | 9 | 2 |
| β-strand | 71-82 | 12 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 10-11 | 2 | 1 |
| α-helix | 19-21 | 3 | |
| α-helix | 22-24 | 3 | |
| β-strand | 25-31 | 7 | 8 |
| β-strand | 40-45 | 6 | 8 |
| β-strand | 50-53 | 4 | 8 |
| α-helix | 58-66 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 10-12 | 3 | 4 |
| β-strand | 13-15 | 3 | 5 |
| β-strand | 21-24 | 4 | 5 |
| β-strand | 27-30 | 4 | 6 |
| β-strand | 33-36 | 4 | 6 |
| α-helix | 37-38 | 2 | |
| β-strand | 42-44 | 3 | 5 |
| α-helix | 48-53 | 6 | |
| α-helix | 54-55 | 2 | |
| β-strand | 60-68 | 9 | 5 |
| β-strand | 71-82 | 12 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 10-12 | 3 | 4 |
| α-helix | 19-21 | 3 | |
| α-helix | 22-24 | 3 | |
| β-strand | 25-30 | 6 | 7 |
| β-strand | 41-45 | 5 | 7 |
| β-strand | 50-53 | 4 | 7 |
| α-helix | 58-71 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Evasin P974 | 1, 3 | protein | 85 | Amblyomma cajennense | A0A023FDY8 (AlphaFold model) |
| chimera protein of C-C motif chemokine 7 and C-C motif chemokine 8,C-C motif chemokine 7 | 2, 4 | protein | 76 | Homo sapiens | P80075 (AlphaFold model), P80098 (AlphaFold model) |
>7S59_1 Evasin P974 (chains 1, 3) DYDYGTDTCPFPVLANKTNKAKFVGCHQKCNGGDQKLTDGTACYVVERKVWDRMTPMLWY ECPLGECKNGVCEDLRKKEDCRKGN
>7S59_2 chimera protein of C-C motif chemokine 7 and C-C motif chemokine 8,C-C motif chemokine 7 (chains 2, 4) QPDSVSIPITCCFNVINKKIPKQRLESYRRTTSSHCPREAVIFKTKLDKEICADPTQKWV QDFMKHLDKKTQTPKL
Structure-guided engineering of tick evasins for targeting chemokines in inflammatory diseases. Bhusal, R.P., Aryal, P., Devkota, S.R. et al. Proc Natl Acad Sci U S A (2022) 119. DOI 10.1073/pnas.2122105119 · PubMed
Other PDB entries of the same protein (UniProt A0A023FDY8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7S59 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.