7SC4: Filamin complex-1

filamin complex-1. Determined by X-ray diffraction at 1.85 Å resolution. Released 12 Apr 2023.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,778
Mol. weight: 26.76 kDa
Released: 12 Apr 2023

Explore 7SC4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7SC4 contains 9 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	2238-2240	3
β-strand	2242-2244	3	1
α-helix	2246-2248	3
β-strand	2251-2252	2	2
β-strand	2257-2262	6	1
β-strand	2269-2277	9	2
β-strand	2282-2287	6	1
β-strand	2292-2298	7	1
β-strand	2303-2311	9	2
β-strand	2314-2315	2	2
α-helix	2316	1
α-helix	2319	1
β-strand	2321-2326	6	2
α-helix	2327-2328	2
β-strand	988-996	9	2

Chain B: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	2238-2240	3
β-strand	2242-2244	3	3
α-helix	2246-2248	3
β-strand	2251-2252	2	4
β-strand	2257-2262	6	3
β-strand	2269-2277	9	4
β-strand	2282-2287	6	3
β-strand	2292-2298	7	3
β-strand	2303-2311	9	4
β-strand	2314-2315	2	4
α-helix	2319	1
β-strand	2321-2326	6	4
α-helix	2327-2328	2
β-strand	988-996	9	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Filamin-A/Integrin alpha-IIb light chain, form 2 chimera	A, B	protein	130	Homo sapiens	P08514 (AlphaFold model), P21333 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7SC4_1 Filamin-A/Integrin alpha-IIb light chain, form 2 chimera (chains A, B)
GGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGV
AYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGGASGSGASGSSGSWKVGFFKRNRPP
LEEDDEEGEG

Primary citation

A mechanism of platelet integrin alpha IIb beta 3 outside-in signaling through a novel integrin alpha IIb subunit-filamin-actin linkage. Liu, J., Lu, F., Ithychanda, S.S. et al. Blood (2023) 141:2629-2641. DOI 10.1182/blood.2022018333 · PubMed

Other PDB entries of the same protein (UniProt P08514 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7UDH 2.0 Å, Integrin alpha IIB beta3 complex with BMS4-3
7UBR 2.05 Å, Integrin alpha IIB beta3 complex with GR144053
3T3P 2.2 Å, A Novel High Affinity Integrin alphaIIbbeta3 Receptor Antagonist That Unexpectedly…
7TMZ 2.2 Å, Integrin alpha IIB beta3 complex with BMS compound 4
3NIG 2.25 Å, The Closed Headpiece of Integrin IIb 3 and its Complex with an IIb 3 -Specific…
7U9V 2.25 Å, Integrin alpha IIB beta3 complex with BMS4-1
3NID 2.3 Å, The Closed Headpiece of Integrin alphaIIB beta3 and its Complex with an alpahIIB beta3…
7L8P 2.35 Å, Integrin alphaIIbbeta3 in complex with sibrafiban
7UCY 2.35 Å, Integrin alpha IIB beta3 complex with gantofiban
3ZE2 2.35 Å, Integrin alphaIIB beta3 headpiece and RGD peptide complex
7UKT 2.37 Å, Integrin alpha IIB beta3 complex with BMS4.2
2VDR 2.4 Å, Integrin AlphaIIbBeta3 Headpiece Bound to a chimeric Fibrinogen Gamma chain peptide,…

Browse structure collections

About this viewer

MolViewer shows 7SC4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.