7SCV: Evasin P1243

Crystal Structure of the Tick Evasin EVA-AAM1001 Complexed to Human Chemokine CCL17. Determined by X-ray diffraction at 2.01 Å resolution. Released 29 Mar 2023.

Method: X-ray diffraction
Resolution: 2.01 Å
Organisms: Amblyomma americanum, Homo sapiens
Chains: 2
Atoms: 1,177
Mol. weight: 19.21 kDa
Released: 29 Mar 2023

Explore 7SCV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7SCV contains 6 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	26-27	2	1
β-strand	29	1	2
β-strand	30-31	2	3
α-helix	35-37	3
β-strand	38	1	2
β-strand	39-40	2	4
β-strand	43-46	4	5
β-strand	49-52	4	5
α-helix	53-54	2
β-strand	58-61	4	4
α-helix	64-69	6
β-strand	77-84	8	4
β-strand	87-96	10	4
β-strand	97-98	2	3

Chain B: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	9-10	2	1
α-helix	18-20	3
α-helix	21-23	3
β-strand	24-29	6	6
β-strand	39-43	5	6
β-strand	48-51	4	6
α-helix	56-67	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Evasin P1243	A	protein	101	Amblyomma americanum	A0A0C9S461 (AlphaFold model)
C-C motif chemokine 17	B	protein	71	Homo sapiens	Q92583 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7SCV_1 Evasin P1243 (chains A)
GSARNHTEDNSTEYYDYEEARCACPARHLNNTNGTVLKLLGCHYFCNGTLCTAPDGYPCY
NLTAQQVRTLTTYPNTSCAVGVCMKGTCVKNGTMEQCFKTP

Sequence of entity 2 (B), FASTA

>7SCV_2 C-C motif chemokine 17 (chains B)
ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKN
AVKYLQSLERS

Primary citation

Engineering broad-spectrum inhibitors of inflammatory chemokines from subclass A3 tick evasins. Devkota, S.R., Aryal, P., Pokhrel, R. et al. Nat Commun (2023) 14:4204-4204. DOI 10.1038/s41467-023-39879-3 · PubMed

Other PDB entries of the same protein (UniProt A0A0C9S461 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7SCS 1.51 Å, Crystal Structure of the Tick Evasin EVA-AAM1001 Complexed to Human Chemokine CCL11
8FK6 1.74 Å, Crystal Structure of the Tick Evasin EVA-AAM1001(Y44A) Complexed to Human Chemokine CCL7
7SCT 1.84 Å, Crystal Structure of the Tick Evasin EVA-AAM1001 Complexed to Human Chemokine CCL16
7SCU 1.86 Å, Crystal Structure of the Tick Evasin EVA-AAM1001 Complexed to Human Chemokine CCL7
8FK8 1.96 Å, Crystal Structure of the Tick Evasin EVA-AAM1001(L39P) Complexed to Human Chemokine CCL7
8FJ2 2.07 Å, Crystal Structure of the Tick Evasin EVA-AAM1001(C8) Complexed to Human Chemokine CCL17
8FJ3 2.07 Å, Crystal Structure of the Tick Evasin EVA-AAM1001 Complexed to Human Chemokine CCL7(Y13A)
8SKK 2.1 Å, Crystal Structure of the Tick Evasin EVA-AAM1001(L39P) Complexed to Human Chemokine CCL17
8FJ0 2.91 Å, Crystal Structure of the Tick Evasin EVA-AAM1001(Y44A) Complexed to Human Chemokine CCL2

Browse structure collections

About this viewer

MolViewer shows 7SCV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.