8SKK: Evasin P1243

Crystal Structure of the Tick Evasin EVA-AAM1001(L39P) Complexed to Human Chemokine CCL17. Determined by X-ray diffraction at 2.1 Å resolution. Released 3 May 2023.

Method: X-ray diffraction
Resolution: 2.1 Å
Organisms: Amblyomma americanum, Homo sapiens
Chains: 2
Atoms: 1,316
Mol. weight: 19.38 kDa
Released: 3 May 2023

Explore 8SKK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8SKK contains 8 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	16-21	6
β-strand	26-27	2	1
β-strand	29	1	2
β-strand	30-31	2	3
α-helix	35-37	3
β-strand	38	1	2
β-strand	40	1	4
β-strand	43-46	4	5
β-strand	49-52	4	5
α-helix	53-54	2
β-strand	58-61	4	4
α-helix	64-68	5
β-strand	77-84	8	4
β-strand	87-96	10	4
β-strand	97-98	2	3

Chain B: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	9-10	2	1
α-helix	21-23	3
β-strand	24-29	6	6
α-helix	30-31	2
β-strand	39-43	5	6
β-strand	48-51	4	6
α-helix	56-64	9
α-helix	66-68	3
β-strand	69	1	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Evasin P1243	A	protein	103	Amblyomma americanum	A0A0C9S461 (AlphaFold model)
C-C motif chemokine 17	B	protein	71	Homo sapiens	Q92583 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8SKK_1 Evasin P1243 (chains A)
GSTSARNHTEDNSTEYYDYEEARCACPARHLNNTNGTVLKPLGCHYFCNGTLCTAPDGYP
CYNLTAQQVRTLTTYPNTSCAVGVCMKGTCVKNGTMEQCFKTP

Sequence of entity 2 (B), FASTA

>8SKK_2 C-C motif chemokine 17 (chains B)
ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKN
AVKYLQSLERS

Primary citation

Crystal Structure of the Tick Evasin EVA-AAM1001(L39P) Complexed to Human Chemokine CCL7. Devkota, S.R., Bhusal, R.P., Aryal, P. et al. To be published.

Other PDB entries of the same protein (UniProt A0A0C9S461 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7SCS 1.51 Å, Crystal Structure of the Tick Evasin EVA-AAM1001 Complexed to Human Chemokine CCL11
8FK6 1.74 Å, Crystal Structure of the Tick Evasin EVA-AAM1001(Y44A) Complexed to Human Chemokine CCL7
7SCT 1.84 Å, Crystal Structure of the Tick Evasin EVA-AAM1001 Complexed to Human Chemokine CCL16
7SCU 1.86 Å, Crystal Structure of the Tick Evasin EVA-AAM1001 Complexed to Human Chemokine CCL7
8FK8 1.96 Å, Crystal Structure of the Tick Evasin EVA-AAM1001(L39P) Complexed to Human Chemokine CCL7
7SCV 2.01 Å, Crystal Structure of the Tick Evasin EVA-AAM1001 Complexed to Human Chemokine CCL17
8FJ2 2.07 Å, Crystal Structure of the Tick Evasin EVA-AAM1001(C8) Complexed to Human Chemokine CCL17
8FJ3 2.07 Å, Crystal Structure of the Tick Evasin EVA-AAM1001 Complexed to Human Chemokine CCL7(Y13A)
8FJ0 2.91 Å, Crystal Structure of the Tick Evasin EVA-AAM1001(Y44A) Complexed to Human Chemokine CCL2

Browse structure collections

About this viewer

MolViewer shows 8SKK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.