7SKY: Pertussis toxin S1

Pertussis toxin S1 bound to NAD+. Determined by X-ray diffraction at 1.37 Å resolution. Released 13 Apr 2022.

Method: X-ray diffraction
Resolution: 1.37 Å
Organism: Bordetella pertussis
Chains: 4
Atoms: 6,564
Mol. weight: 86.13 kDa
Ligands: NAD
Released: 13 Apr 2022

Explore 7SKY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7SKY contains 26 α-helices and 47 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3
β-strand	6-11	6	4
α-helix	15-21	7
β-strand	23-24	2	5
β-strand	29	1	6
α-helix	32-36	5
β-strand	48	1	6
β-strand	50-54	5	4
α-helix	57-76	20
β-strand	84-92	9	4
β-strand	97-99	3	4
α-helix	100-111	12
α-helix	114-116	3
β-strand	129-133	5	4
β-strand	135-136	2	5
α-helix	138-140	3
β-strand	141-149	9	4
β-strand	156-162	7	4
β-strand	174	1	4

Chains B and D: 6 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3
β-strand	6-11	6	1
α-helix	15-21	7
β-strand	23-24	2	2
β-strand	29	1	3
α-helix	32-36	5
β-strand	48	1	3
β-strand	50-54	5	1
α-helix	57-76	20
β-strand	84-92	9	1
β-strand	97-99	3	1
α-helix	100-111	12
β-strand	129-133	5	1
β-strand	135-136	2	2
α-helix	138-140	3
β-strand	141-149	9	1
β-strand	156-162	7	1
β-strand	174	1	1

Chain C: 7 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3
β-strand	6-11	6	7
α-helix	15-21	7
β-strand	23-24	2	8
β-strand	29	1	9
α-helix	32-36	5
β-strand	48	1	9
β-strand	50-54	5	7
α-helix	57-76	20
β-strand	83-92	10	7
β-strand	97-99	3	7
α-helix	100-111	12
α-helix	114-116	3
β-strand	129-133	5	7
β-strand	135-136	2	8
α-helix	138-140	3
β-strand	141-150	10	7
β-strand	156-162	7	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Pertussis toxin subunit 1	A, B, C, D	protein	184	Bordetella pertussis	P04977 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>7SKY_1 Pertussis toxin subunit 1 (chains A, B, C, D)
GPGDPPATVYRYDSRPPEDVFQNGFTAWGNNDNVLEHLTGRSCQVGSSNSAFVSTSSSRR
YTEVYLEHRMQEAVEAERAGRGTGHFIGYIYEVRADNNFYGAASSYFEYVDTYGDNAGRI
LAGALATYQSEYLAHRRIPPENIRRVTRVYHNGITGETTTTEYSNARYVSQQTRANPNPY
TSRR

Ligands and cofactors

ID	Name	Formula	Copies
NAD	Nicotinamide-adenine-dinucleotide	C21 H27 N7 O14 P2	4

Water and common crystallization additives (IOD) are not listed.

Primary citation

Crystal structures of pertussis toxin with NAD + and analogs provide structural insights into the mechanism of its cytosolic ADP-ribosylation activity. Sakari, M., Tran, M.T., Rossjohn, J. et al. J Biol Chem (2022) 298:101892-101892. DOI 10.1016/j.jbc.2022.101892 · PubMed

Other PDB entries of the same protein (UniProt P04977 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7SNE 1.0 Å, Pertussis toxin S1 subunit bound to BaAD
7SKI 1.1 Å, Pertussis toxin in complex with PJ34
7U6Z 1.3 Å, Pertussis toxin E129D NAD
7SKK 1.65 Å, pertussis toxin in complex with ADPR and Nicotinamide
6RO0 2.13 Å, Crystal structure of genetically detoxified pertussis toxin gdpt.
1BCP 2.7 Å, Binary complex of pertussis toxin and ATP
1PRT 2.9 Å, The crystal structure of pertussis toxin
1PTO 3.5 Å, The structure of a pertussis toxin-sugar complex as a model for receptor binding
9MR7 3.56 Å, Genetiocally detoxified pertussis toxin in complex with hu1B7 Fab and hu11E6 Fab

Browse structure collections

About this viewer

MolViewer shows 7SKY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.