7SNS: 1.55A Resolution Structure of NanoLuc Luciferase

1.55A Resolution Structure of NanoLuc Luciferase. Determined by X-ray diffraction at 1.55 Å resolution. Released 16 Nov 2022.

Method: X-ray diffraction
Resolution: 1.55 Å
Organism: Oplophorus gracilirostris
Chains: 4
Atoms: 6,081
Mol. weight: 78.9 kDa
Released: 16 Nov 2022

Explore 7SNS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7SNS contains 21 α-helices and 48 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	3-6	4
β-strand	8-16	9	1
α-helix	18-24	7
α-helix	30-34	5
β-strand	36-37	2	2
β-strand	41-46	6	1
β-strand	51-61	11	1
α-helix	67-77	11
β-strand	81-84	4	1
β-strand	87-98	12	1
α-helix	104	1
β-strand	105-109	5	1
β-strand	112-120	9	1
β-strand	124-130	7	1
β-strand	136-143	8	1
α-helix	148	1
β-strand	149-155	7	1
β-strand	158-166	9	1
α-helix	167-168	2

Chain B: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	3-6	4
β-strand	8-16	9	3
α-helix	18-24	7
β-strand	36-37	2	4
β-strand	41-47	7	3
β-strand	51-61	11	3
α-helix	67-77	11
β-strand	81-84	4	3
β-strand	87-98	12	3
β-strand	105-109	5	3
β-strand	112-120	9	3
β-strand	124-130	7	3
β-strand	136-143	8	3
β-strand	149-155	7	3
β-strand	158-166	9	3

Chain C: 5 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	3-6	4
β-strand	8-16	9	2
α-helix	18-24	7
α-helix	30-34	5
β-strand	36-37	2	1
β-strand	41-47	7	2
β-strand	51-61	11	2
α-helix	67-77	11
β-strand	80-84	5	2
β-strand	87-98	12	2
α-helix	104	1
β-strand	105-109	5	2
β-strand	112-120	9	2
β-strand	124-130	7	2
β-strand	136-143	8	2
β-strand	149-155	7	2
β-strand	158-166	9	2

Chain D: 6 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	3-6	4
β-strand	8-16	9	4
α-helix	18-24	7
α-helix	30-34	5
β-strand	36-37	2	3
β-strand	41-47	7	4
β-strand	51-61	11	4
α-helix	67-77	11
β-strand	81-84	4	4
β-strand	87-98	12	4
β-strand	105-109	5	4
β-strand	112-120	9	4
β-strand	125-130	6	4
β-strand	136-143	8	4
α-helix	148	1
β-strand	149-155	7	4
β-strand	158-166	9	4
α-helix	167-168	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Oplophorus-luciferin 2-monooxygenase catalytic subunit	A, B, C, D	protein	174	Oplophorus gracilirostris	Q9GV45 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>7SNS_1 Oplophorus-luciferin 2-monooxygenase catalytic subunit (chains A, B, C, D)
SDNMVFTLEDFVGDWRQTAGYNLDQVLEQGGVSSLFQNLGVSVTPIQRIVLSGENGLKID
IHVIIPYEGLSGDQMGQIEKIFKVVYPVDDHHFKVILHYGTLVIDGVTPNMIDYFGRPYE
GIAVFDGKKITVTGTLWNGNKIIDERLINPDGSLLFRVTINGVTGWRLCERILA

Primary citation

1.55A Resolution Structure of NanoLuc Luciferase. Encell, L.P., Lovell, S., Mehzabeen, N. et al. To be published.

Other PDB entries of the same protein (UniProt Q9GV45 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8AQ6 1.69 Å, NanoLuc luciferase with bound furimamide in surface allosteric site
7VSX 1.7 Å, Crystal structure of QL-nanoKAZ (Reverse mutant of nanoKAZ with L18Q and V27L)
7SNX 1.7 Å, 1.70A Resolution Structure of NanoBiT Complementation Reporter Complex of LgBit and…
5B0U 1.71 Å, Crystal structure of the mutated 19 kDa protein of Oplophorus luciferase (nanoKAZ)
7SNW 1.8 Å, 1.80A Resolution Structure of NanoLuc Luciferase with Bound Inhibitor PC 16026576
5IBO 1.95 Å, 1.95A resolution structure of NanoLuc luciferase
8AQI 1.99 Å, NanoLuc luciferase with bound coelenteramide in surface allosteric site
7SNR 2.0 Å, 2.00A Resolution Structure of NanoLuc Luciferase
7SNY 2.1 Å, 2.10A Resolution Structure of NanoBiT Complementation Reporter Large Subunit LgBiT
7SNT 2.2 Å, 2.20A Resolution Structure of NanoLuc Luciferase with Bound Substrate Analog…
9UPV 2.7 Å, Cryo-EM structure of CXCR4 complexed with agonist SDVX1
8AQH 2.8 Å, NanoLuc-Y94A luciferase mutant

Browse structure collections

About this viewer

MolViewer shows 7SNS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.