7VSX: QL-nanoKAZ

Crystal structure of QL-nanoKAZ (Reverse mutant of nanoKAZ with L18Q and V27L). Determined by X-ray diffraction at 1.7 Å resolution. Released 24 Aug 2022.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Oplophorus gracilirostris
Chains: 1
Atoms: 1,541
Mol. weight: 19.38 kDa
Released: 24 Aug 2022

Explore 7VSX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7VSX contains 5 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	3-6	4
β-strand	8-16	9	1
α-helix	18-24	7
α-helix	29-37	9
β-strand	41-47	7	1
β-strand	51-61	11	1
α-helix	67-77	11
β-strand	81-82	2	1
β-strand	87-98	12	1
β-strand	105-109	5	2
β-strand	112-116	5	2
β-strand	117-120	4	1
β-strand	124-130	7	1
β-strand	136-143	8	1
β-strand	149-155	7	1
β-strand	158-166	9	1
α-helix	167-168	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
QLnK	A	protein	171	Oplophorus gracilirostris	Q9GV45 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7VSX_1 QLnK (chains A)
EFFTLEDFVGDWRQTAGYNQDQVLEQGGLSSLFQNLGVSVTPIQRIVLSGENGLKIDIHV
IIPYEGLSGDQMGQIEKIFKVVYPVDDHHFKVILHYGTLVIDGVTPNMIDYFGRPYEGIA
VFDGKKITVTGTLWNGNKIIDERLINPDGSLLFRVTINGVTGWRLCERILA

Primary citation

Reverse mutants of the catalytic 19 kDa mutant protein (nanoKAZ/nanoLuc) from Oplophorus luciferase with coelenterazine as preferred substrate. Inouye, S., Sato, J.I., Sahara-Miura, Y. et al. PLoS One (2022) 17:e0272992-e0272992. DOI 10.1371/journal.pone.0272992 · PubMed

Other PDB entries of the same protein (UniProt Q9GV45 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7SNS 1.55 Å, 1.55A Resolution Structure of NanoLuc Luciferase
8AQ6 1.69 Å, NanoLuc luciferase with bound furimamide in surface allosteric site
7SNX 1.7 Å, 1.70A Resolution Structure of NanoBiT Complementation Reporter Complex of LgBit and…
5B0U 1.71 Å, Crystal structure of the mutated 19 kDa protein of Oplophorus luciferase (nanoKAZ)
7SNW 1.8 Å, 1.80A Resolution Structure of NanoLuc Luciferase with Bound Inhibitor PC 16026576
5IBO 1.95 Å, 1.95A resolution structure of NanoLuc luciferase
8AQI 1.99 Å, NanoLuc luciferase with bound coelenteramide in surface allosteric site
7SNR 2.0 Å, 2.00A Resolution Structure of NanoLuc Luciferase
7SNY 2.1 Å, 2.10A Resolution Structure of NanoBiT Complementation Reporter Large Subunit LgBiT
7SNT 2.2 Å, 2.20A Resolution Structure of NanoLuc Luciferase with Bound Substrate Analog…
9UPV 2.7 Å, Cryo-EM structure of CXCR4 complexed with agonist SDVX1
8AQH 2.8 Å, NanoLuc-Y94A luciferase mutant

Browse structure collections

About this viewer

MolViewer shows 7VSX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.