7SO0: Evasin P974

Crystal Structure of the Engineered Tick Evasin EVA-P974(F31A) Complexed to Human Chemokine CCL2. Determined by X-ray diffraction at 1.74 Å resolution. Released 16 Mar 2022.

Method: X-ray diffraction
Resolution: 1.74 Å
Organisms: Amblyomma cajennense, Homo sapiens
Chains: 2
Atoms: 1,288
Mol. weight: 18.3 kDa
Released: 16 Mar 2022

Explore 7SO0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7SO0 contains 6 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	11-12	2	1
β-strand	13-16	4	2
β-strand	22-24	3	2
β-strand	27-30	4	3
β-strand	33-36	4	3
α-helix	37-38	2
β-strand	42-44	3	2
α-helix	48-52	5
α-helix	55	1
β-strand	60-68	9	2
β-strand	71-82	12	2

Chain B: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	10-11	2	1
α-helix	19-21	3
α-helix	22-24	3
β-strand	25-31	7	4
β-strand	40-45	6	4
β-strand	50-53	4	4
α-helix	58-72	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Evasin P974	A	protein	85	Amblyomma cajennense	A0A023FDY8 (AlphaFold model)
C-C motif chemokine 2	B	protein	76	Homo sapiens	P13500 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7SO0_1 Evasin P974 (chains A)
DYDYGTDTCPFPVLANKTNKAKAVGCHQKCNGGDQKLTDGTACYVVERKVWDRMTPMLWY
ECPLGECKNGVCEDLRKKEDCRKGN

Sequence of entity 2 (B), FASTA

>7SO0_2 C-C motif chemokine 2 (chains B)
QPDAINAAVTCCYNFTNRKISVQRLASYRRITSSKCPKEAVIFKTIVAKEICADPKQKWV
QDSMDHLDKQTQTPKT

Primary citation

Structure-guided engineering of tick evasins for targeting chemokines in inflammatory diseases. Bhusal, R.P., Aryal, P., Devkota, S.R. et al. Proc Natl Acad Sci U S A (2022) 119. DOI 10.1073/pnas.2122105119 · PubMed

Other PDB entries of the same protein (UniProt A0A023FDY8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7S4N 1.65 Å, Crystal structure of the tick evasin EVA-P974 complexed to human chemokine CCL17
7S58 1.82 Å, Crystal Structure of the tick evasin EVA-P974 complexed to human chemokine CCL7
7S59 2.39 Å, Crystal structure of the tick evasin EVA-P974 complexed to a chimera made of human…

Browse structure collections

About this viewer

MolViewer shows 7SO0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.