7SQ2: PDB entry 7SQ2

Reprocessed and refined structure of Phospholipase C-beta and Gq signaling complex. Determined by X-ray diffraction at 2.6 Å resolution. Released 17 Nov 2021.

Method: X-ray diffraction
Resolution: 2.6 Å
Organisms: Mus musculus, Homo sapiens
Chains: 2
Atoms: 8,957
Mol. weight: 139.17 kDa
Ligands: ALF, MG, GDP, CA
Released: 17 Nov 2021

Explore 7SQ2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7SQ2 contains 59 α-helices and 49 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	39-46	8	1
α-helix	52-63	12
α-helix	69-73	5
α-helix	76-96	21
α-helix	105-114	10
α-helix	118-120	3
α-helix	128-136	9
α-helix	139-146	8
α-helix	148-150	3
α-helix	157-161	5
α-helix	164-168	5
α-helix	176-180	5
β-strand	189-196	8	1
β-strand	199-206	8	1
α-helix	210-219	10
β-strand	225-231	7	1
α-helix	232-236	5
β-strand	238-239	2	2
β-strand	242-246	5	2
α-helix	247-258	12
α-helix	262-264	3
β-strand	268-274	7	1
α-helix	276-282	7
α-helix	288-290	3
α-helix	302-314	13
β-strand	325-328	4	1
α-helix	334-350	17

Chain B: 40 helices, 41 β-strands

Element	Residues	Length	Sheet
α-helix	20-24	5
β-strand	26-30	5	3
β-strand	39-45	7	3
β-strand	51-55	5	3
β-strand	61-65	5	3
α-helix	66-68	3
β-strand	69-74	6	4
α-helix	75-77	3
β-strand	104-108	5	4
β-strand	116-119	4	4
β-strand	120-122	3	3
α-helix	128-139	12
α-helix	142-145	4
α-helix	149-162	14
β-strand	170-171	2	5
α-helix	173-178	6
α-helix	183-193	11
β-strand	202-203	2	5
α-helix	205-207	3
α-helix	210-220	11
α-helix	224-232	9
β-strand	240-242	3	6
α-helix	243-252	10
α-helix	265-267	3
α-helix	269-279	11
α-helix	283-287	5
β-strand	290-292	3	6
α-helix	293-300	8
α-helix	310-313	4
α-helix	323-325	3
β-strand	326-328	3	7
β-strand	330	1	8
β-strand	331	1	9
β-strand	336	1	10
β-strand	345	1	10
α-helix	348-355	8
β-strand	360-365	6	8
α-helix	367-369	3
β-strand	376-377	2	8
β-strand	387-388	2	8
α-helix	389-399	11
β-strand	408-414	7	8
α-helix	419-433	15
α-helix	434-436	3
β-strand	437	1	8
α-helix	451-455	5
α-helix	457-459	3
β-strand	463-466	4	8
α-helix	578-581	4
α-helix	588-591	4
β-strand	594	1	8
β-strand	598-599	2	11
α-helix	605-611	7
β-strand	616-617	2	11
β-strand	618-621	4	12
α-helix	622-631	10
α-helix	633-640	8
β-strand	645-648	4	12
α-helix	662-665	4
β-strand	671-672	2	12
β-strand	674	1	9
α-helix	681-691	11
α-helix	693-695	3
β-strand	698-700	3	7
α-helix	701-702	2
α-helix	703-705	3
β-strand	726-736	11	13
β-strand	745-752	8	13
α-helix	755-757	3
β-strand	759	1	13
β-strand	763	1	13
β-strand	775	1	13
β-strand	781-786	6	13
α-helix	789-791	3
β-strand	793-800	8	13
β-strand	805-812	8	13
β-strand	819-826	8	13
α-helix	831	1
β-strand	832-846	15	13
α-helix	853-860	8
α-helix	862-874	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Guanine nucleotide-binding protein G(q) subunit alpha	A	protein	327	Mus musculus	P21279 (AlphaFold model)
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3	B	protein	885	Homo sapiens	Q01970 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7SQ2_1 Guanine nucleotide-binding protein G(q) subunit alpha (chains A)
GADARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIR
AMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQ
LSDSTKYYLNDLDRVADPSYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSE
RRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILF
LNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCAT
DTENIRFVFAAVKDTILQLNLKEYNLV

Sequence of entity 2 (B), FASTA

>7SQ2_2 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 (chains B)
GAMDPEFMALQLEPPTVVETLRRGSKFIKWDEETSSRNLVTLRVDPNGFFLYWTGPNMEV
DTLDISSIRDTRTGRYARLPKDPKIREVLGFGGPDARLEEKLMTVVSGPDPVNTVFLNFM
AVQDDTAKVWSEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFSA
DKKRVETALESCGLKFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPYL
TLEQLMDFINQKQRDPRLNEVLYPPLRPSQARLLIEKYEPNQQFLERDQMSMEGFSRYLG
GEENGILPLEALDLSTDMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGCRCV
ELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAKQ
QAKMAEYCRSIFGDALLIEPLDKYPLAPGVPLPSPQDLMGRILVKNKKRHRPSAGGPDSA
GRKRPLEQSNSALSESSAATEPSSPQLGSPSSDSCPGLSNGEEVGLEKPSLEPQKSLGDE
GLNRGPYVLGPADREDEEEDEEEEEQTDPKKPTTDEGTASSEVNATEEMSTLVNYIEPVK
FKSFEAARKRNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNYMP
QLFWNVGCQLVALNFQTLDVAMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVIVD
GIVANALRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWDEEPF
DFPKVVLPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYVCLRNEANQPLCLPALLIY
TEASDYIPDDHQDYAEALINPIKHVSLMDQRARQLAALIGESEAQ

Ligands and cofactors

ID	Name	Formula	Copies
ALF	Tetrafluoroaluminate ion	Al F4	1
MG	Magnesium ion	Mg	2
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	1
CA	Calcium ion	Ca	1

Water and common crystallization additives (ACT) are not listed.

Primary citation

Kinetic Scaffolding Mediated by a Phospholipase C-{beta} and Gq Signaling Complex. Endo-Streeter, S.T., Sondek, J., Harden, T.K. Science (2010) 330:974-980. DOI 10.1126/science.1193438 · PubMed

Other PDB entries of the same protein (UniProt P21279 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5DO9 2.6 Å, Structure of regulator of G protein signaling 8 (RGS8) in complex with AlF4-activated…
4EKD 2.71 Å, Structure of human regulator of G protein signaling 2 (RGS2) in complex with murine…
8YFS 2.8 Å, MRGPRE-Gq-scFv16-complex
3AH8 2.9 Å, Structure of heterotrimeric G protein Galpha-q beta gamma in complex with an inhibitor…
4QJ3 3.0 Å, Structure of a fragment of human phospholipase C-beta3 delta472-559, in complex with…
2BCJ 3.06 Å, Crystal Structure of G Protein-Coupled Receptor Kinase 2 in Complex with Galpha-q and…
4QJ4 3.3 Å, Structure of a fragment of human phospholipase C-beta3 delta472-569, bound to IP3 and in…
4QJ5 3.41 Å, Structure of a fragment of human phospholipase C-beta3 delta472-581, bound to IP3 and in…
2RGN 3.5 Å, Crystal Structure of p63RhoGEF complex with Galpha-q and RhoA
4GNK 4.0 Å, Crystal structure of Galphaq in complex with full-length human PLCbeta3
4EKC 7.4 Å, Structure of human regulator of G protein signaling 2 (RGS2) in complex with murine…

Browse structure collections

About this viewer

MolViewer shows 7SQ2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.