X-ray Crystal Structure of Truncated Human Chemokine CCL19 (7-70). Determined by X-ray diffraction at 2.5 Å resolution. Released 23 Feb 2022.
Explore 7STA in 3D Show helices and sheets RCSB PDB PDBe
7STA contains 16 α-helices and 16 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 12 | 1 | 1 |
| α-helix | 16-18 | 3 | |
| α-helix | 19-21 | 3 | |
| β-strand | 22-28 | 7 | 1 |
| α-helix | 30-32 | 3 | |
| β-strand | 38-43 | 6 | 1 |
| β-strand | 48-51 | 4 | 1 |
| α-helix | 56-67 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 12 | 1 | 3 |
| α-helix | 16-18 | 3 | |
| α-helix | 19-21 | 3 | |
| β-strand | 22-28 | 7 | 3 |
| α-helix | 30-32 | 3 | |
| β-strand | 38-43 | 6 | 3 |
| β-strand | 48-51 | 4 | 3 |
| α-helix | 56-68 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| C-C motif chemokine 19 | A, B, C, D | protein | 64 | Homo sapiens | Q99731 (AlphaFold model) |
>7STA_1 C-C motif chemokine 19 (chains A, B, C, D) DCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQ RTSA
Structural Insights into Molecular Recognition by Human Chemokine CCL19. Lewandowski, E.M., Kroeck, K.G., Jacobs, L.M.C. et al. Biochemistry (2022) 61:311-318. DOI 10.1021/acs.biochem.1c00759 · PubMed
Other PDB entries of the same protein (UniProt Q99731 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7STA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.